KEGG   Haliscomenobacter hydrossis: Halhy_3320Help
Entry
Halhy_3320        CDS       T01491                                 

Definition
Xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hhy00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Halhy_3320
   00051 Fructose and mannose metabolism
    Halhy_3320
Enzymes [BR:hhy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Halhy_3320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4187142..4188476
Genome map
AA seq 444 aa AA seqDB search
MSNSVVLGNREYFPGIGKIQFEGAGSDNPLAFKYYDENRVVAGKTMKEHFRFATAYWHTF
CGTGGDPFGPGTKKFPWLEASDAVQSAKDKMDAAFEFFTKIGTPYFCFHDVDLVDEGPSL
AESERRLSAIVDYAKEKIAASGVKVLWGTANLFSNPRYMNGAATSPDFSVAAYAGAQLKN
AIDATIALNGENYVFWGGREGYMSLLNTDMKREQEHLARMLSMSRDYARSQGFKGVFFIE
PKPMEPSKHQYDFDCATVVGFLNRYGLADDFKINIEVNHATLALHTFQHELQVAADAGML
GSIDANRGDYQNGWDTDQFPNNVMELTESMLVILQAGGLQGGGVNFDAKTRRNSTDLIDI
FYAHIGGMDVFARALIAADAVLSKSKFLAMRKERYASYDSGKGKEFEDGKLSLQDLHALA
HANPEPGLSSGRQELYENILTQYT
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgagtaattctgttgtattggggaatcgcgagtattttcccgggattgggaaaatacag
tttgaaggagctggctccgacaatccgctggcctttaaatactacgatgaaaatcgggta
gtggcgggcaaaaccatgaaagagcattttcgctttgctacggcttattggcatactttc
tgtggtacaggtggagatccctttggcccgggcactaaaaagttcccctggttggaggca
agtgacgcggtacagtctgccaaggacaaaatggatgccgcatttgagttttttaccaaa
attggcacgccctatttttgtttccacgatgtggatttggtagacgaaggccccagcctc
gctgaaagcgagcgacggttaagcgccatcgttgactacgccaaagaaaagattgctgct
tcaggggtaaaggtgctgtggggaacggccaatttgttttccaatccccgctacatgaat
ggcgcggccaccagcccggattttagtgtagcagcatatgctggagcgcagctcaaaaat
gccatcgatgccaccattgcactcaatggagaaaactacgtattctggggtggtcgtgaa
ggttacatgtctttgctgaatactgacatgaagcgggagcaagagcacttggcccgtatg
ttgagcatgtcgcgggattatgcccgcagccaaggcttcaaaggggtgttttttatcgaa
cccaaacccatggagcccagtaagcaccagtacgattttgactgtgctacggtggttggt
ttcctcaaccgttatggtctggctgatgattttaaaatcaacatcgaagtaaaccacgcc
actttggcgctgcatactttccagcacgagctacaagtggccgccgatgcgggcatgttg
ggcagcattgacgccaaccgtggcgattaccaaaatggctgggataccgaccagttcccc
aacaacgttatggaattgacggagtcgatgttggtgatcctgcaagctggtggtttacaa
ggcggtggggtgaattttgatgccaaaacccgccgtaactccaccgatctgatcgatatc
ttctacgcccacattggtggtatggatgtgtttgcccgggctttgattgctgccgacgcg
gttttgagcaagtcgaaatttttggccatgcgcaaagagcgttatgctagttacgacagc
ggcaaaggcaaggagtttgaagatggaaaactcagcctgcaagatctgcatgctttggcc
cacgccaatcctgagccgggattgagcagcggaagacaggagttgtacgagaacatcctg
actcagtacacatag

DBGET integrated database retrieval system