KEGG   Haliscomenobacter hydrossis: Halhy_3456Help
Entry
Halhy_3456        CDS       T01491                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hhy00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Halhy_3456
Enzymes [BR:hhy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Halhy_3456
Transfer RNA biogenesis [BR:hhy03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Halhy_3456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4359616..4360401)
Genome map
AA seq 261 aa AA seqDB search
MNNKQLIAEITQIARRAGEAILKIYANEADFQVEHKSDSSPLTIADRTANAIICSALEAL
HVQYPIISEENKQIPYAERQHFQKAWLVDPLDGTKEFLKRNGDFTVNIALINAGVIELGV
VYIPVFDEMYYAAKGEGAFVAKAGKVEPIQALPFSMSDPGLKVICSRSHMSPETEVFIQQ
LDQPELVSRGSSLKFLLIAMGQAHVYPRMGPTMEWDTGAAQIILEEAGGEVIDQNTQQPL
RYNKENLLNPYFVAYGKVSAR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacaagcaactaattgcagaaattacccaaattgcccgacgtgcgggtgaagcc
attctgaaaatttatgccaatgaggccgattttcaagtagagcacaaatcagactcttcc
cccctcaccatcgcggatcgtacagccaatgcaattatttgtagtgcattagaagccctt
catgtgcaatatccaattatttcggaagaaaacaagcagattccttacgctgagcgtcaa
catttccaaaaggcctggctcgtagaccccctggacggcaccaaagaattcctcaaacgc
aatggcgatttcaccgtcaatattgcgttgatcaatgcaggggtgatcgaattgggggtg
gtgtacattcccgtttttgacgaaatgtactacgccgcaaagggtgaaggtgcttttgta
gcaaaagcagggaaagtggaaccaattcaggcacttcccttttccatgagtgatcctggg
ctaaaagttatctgttcgcgctcccacatgagcccagagaccgaagtttttattcagcag
cttgaccaacccgaattggtctcacggggcagctccctcaaatttttgctcatcgccatg
ggccaggcgcacgtgtacccacgcatggggccaaccatggaatgggacacgggtgccgcg
caaatcatcctggaagaagcgggcggagaggtgattgatcaaaacacccagcagcctttg
cgttacaataaggaaaatctgttgaatccttattttgtggcgtacggaaaagtatccgcg
cgttag

DBGET integrated database retrieval system