KEGG   Haliscomenobacter hydrossis: Halhy_3549Help
Entry
Halhy_3549        CDS       T01491                                 

Definition
cytochrome-c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
hhy  Haliscomenobacter hydrossis
Brite
Enzymes [BR:hhy01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Halhy_3549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4465169..4466398
Genome map
AA seq 409 aa AA seqDB search
MKKITLLSTLVLGLLIGLTACYEKMEFGDTLAEPKLPDQVLDYASIQMPEHMKNTFLGFS
NNIFGVNNGKPIDSFPINNPFPIDPNTGINNFANIGPPNPVVTNYGATLGRVLFYDPRLS
INNSISCASCHKQELAFADNAQFSKGFGGKLTPRNSMAILNSGLNHNLFWDSRVHSVTQL
ALEPVRNHIEMGMESMEVLEKKLGNTTFYPELFAKAFGNSQVSSEKIANAMAQFVCSIIS
SNSKFDKGVSKDFSNFTELEKMGKALFFSAKTKCAECHAGQNFSAPDNPHSNDPYGMPGI
EGTAVIGLELFSKDKGKDNGNFRIPSLRNIALTGPYMHDGRFTSLDQVVEHYNSGIQAHP
ELDPKFIDQDGKPLKMNLNAIEKKALVAFLRTLTDEQITKDQRYANPFN
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattacgctactctctacgcttgtgctcggcctactgattggccttactgcc
tgttatgaaaaaatggagtttggcgataccctggccgaacccaagctgcctgatcaggta
ttggattatgcttccatacaaatgccggagcacatgaagaatacttttttggggttcagc
aacaacatttttggggtcaacaatggaaaacctattgattcttttcccattaacaatccc
ttccccattgatcccaatactggcatcaacaattttgccaatatcggcccccccaatccc
gtggtgaccaactatggtgcaaccctcgggcgggtacttttttacgacccccgtttgtcc
atcaacaactccatctcttgtgcttcctgccacaaacaagaattggcttttgcggataat
gctcaattcagcaaaggatttgggggcaaactcactccacgcaactctatggccatcctc
aactcaggactgaaccacaacctgttttgggactcacgcgtacattccgtgacccaactg
gcgctggaacccgtacgcaaccacatcgaaatgggcatggaatcgatggaagtgttggag
aaaaaactgggcaataccactttttatcctgagctctttgccaaagcttttggcaactcg
caggtaagtagtgaaaaaattgccaacgccatggcacagttcgtttgttcgatcatttcg
agcaattccaaatttgacaaaggagtctccaaggactttagcaacttcaccgagttggaa
aaaatgggcaaagccttgttcttcagtgctaagacaaaatgtgcagagtgtcatgctggc
cagaatttctctgctcccgataatccgcattccaatgacccttatggtatgcccggcatt
gagggcactgccgtaattggcctggagctttttagcaaagacaaaggcaaggacaatgga
aatttccgcattcccagcctacgcaatatcgccctcactggcccgtacatgcacgatggc
cgcttcacttcacttgatcaagtggtggaacattacaatagtggcatccaagcccaccct
gaacttgatccaaaatttatcgaccaggacggcaaacccctcaagatgaatctcaacgcc
atcgagaaaaaagccttggtggccttcctccggactttgacagatgagcagatcacgaag
gatcagcgttatgcgaatccgttcaattga

DBGET integrated database retrieval system