KEGG   Haliscomenobacter hydrossis: Halhy_3578Help
Entry
Halhy_3578        CDS       T01491                                 

Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
hhy00020  Citrate cycle (TCA cycle)
hhy00310  Lysine degradation
hhy01100  Metabolic pathways
hhy01110  Biosynthesis of secondary metabolites
hhy01120  Microbial metabolism in diverse environments
hhy01130  Biosynthesis of antibiotics
hhy01200  Carbon metabolism
Module
hhy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hhy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hhy00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Halhy_3578
  Amino acid metabolism
   00310 Lysine degradation
    Halhy_3578
Enzymes [BR:hhy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Halhy_3578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: AEE51432
UniProt: F4KXS1
Position
complement(4502787..4504112)
Genome map
AA seq 441 aa AA seqDB search
MAQFELIMPKMGESIMEATILKWVKNVGDQIELDETIVEIATDKVDSEVPSPVAGKVVQV
LFAENDTVPIGKVIALIETESTTAEPKASPALAEPTPQINGQTPAAAASNGAPASSAQPI
GKGEGSRFYSPLVRNIAQQENISLQELELITGSGMQGRVTKKDIFSYLEDRKEGPASSPA
IKPGTAPSKGSPVQVNYTAPAVSLDGNVEIIEMDRMRKLIAEHMVMSKHVSPHVTSFVEV
DVTNIVKWREKVKDVFQKKYNEKITYTPVFIEAVARAIRDFPMINISVDGTNIVVRKDVN
IGMAAALPSGNLIVPVIKGADQLNLTGLTKSVNDLANRARNNQLKPEDIQGGTFTITNVG
TFGNVMGTPIINQPQVAIMAVGAIRKKPAVLETEYGDIIAVRHMMFLSMSYDHRVVDGFL
GGSFLKRVADYLEGFDVERAV
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagttcgaattgatcatgcccaagatgggggaaagcatcatggaggccaccatc
ctgaaatgggtgaaaaacgtgggcgatcagatagagttggacgaaaccatcgtggagatc
gctacggacaaagtagactctgaagtgccctcacccgttgcgggcaaagtggttcaggtg
ctttttgccgaaaacgacaccgtgcccatcggcaaggtcattgccctgattgaaacagaa
agtactaccgccgaacccaaggcttcaccagccctggcggaaccgactccgcagatcaat
ggccaaactccggctgccgcagccagcaatggcgcaccggccagcagcgctcagccaatc
ggaaaaggggaagggagccgtttttactcgcctctggtgcgcaacatcgcccaacaggaa
aacatcagcctacaagaactggagctgattacgggttccggcatgcagggccgcgtcacc
aaaaaagacatcttttcttatttggaagaccgcaaagaaggcccggccagcagcccggct
atcaagcccggcaccgcgcccagcaaaggcagcccggttcaggtgaactacaccgctccc
gcagtcagcctggatggcaatgtggaaattatagaaatggaccgcatgcgcaaactcatc
gccgagcacatggtgatgtcgaagcacgtgtcgccgcacgtcacctcctttgtggaagta
gacgtgaccaacatcgtcaagtggcgcgaaaaggtcaaagacgtttttcagaaaaaatac
aacgaaaaaatcacctatacgccggtattcattgaggcggtagcccgtgccatccgcgat
tttccgatgatcaacatctcggtggacggcaccaacatcgtcgtacgcaaggatgtgaac
atcggcatggccgccgcgctgcccagtggcaacctgatcgtgcccgtcatcaaaggggcc
gaccaactgaacctcacgggtttaaccaaatcggtgaacgatctagccaaccgcgcccgt
aacaaccaactcaaaccggaagacatccagggtggtacttttaccatcaccaacgtgggt
acctttggcaacgtgatgggcacccccatcatcaatcagccacaagtggccataatggca
gttggagccattcgcaaaaaaccggcggtactggaaacggagtacggcgacatcatcgcg
gtgcgccacatgatgttcctctcgatgtcttatgaccaccgcgtggtggatggtttcctc
gggggatccttcctgaagcgcgtggcggattatttggagggatttgatgtggagcgggcg
gtgtga

DBGET integrated database retrieval system