KEGG   Haliscomenobacter hydrossis: Halhy_3666Help
Entry
Halhy_3666        CDS       T01491                                 

Definition
(GenBank) Cellulase
Organism
hhy  Haliscomenobacter hydrossis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4619756..4620805)
Genome map
AA seq 349 aa AA seqDB search
MINVQLLKRICETPGAPGFEQRIRQLVIKEVQGLVDELSVDNMGNVVAIKRGKERKRAMI
AAHLDEIGFIVNHIDEEGFLFFHPLGGFDPKTLTSQRVIVHGKKDVIGVMGSKPIHLMKP
EERNKVVPMTDYYIDLGMRKEEVIKIVSIGDPVTRERELIEMGDCVNSKSLDNRVSVFIL
IETLRALQGVEIPYDIYGVFTVQEEVGLRGAISAAHGINPDFGFGLDVTIAFDTPGAQAQ
EAVTKLGKGAGIKILDGSVISDYRMVRYLKETADTFNIPWQPEILPAGGTDTAGVQRYGK
KGAIAGAISIPLRHIHQTIEMANKADIQHCTDLLIVALQHLHEFNWEFR
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgataaacgtacaattgctcaaacgcatttgtgaaacccccggagccccgggtttcgag
caacggattcgccagttggtgatcaaagaagtacaaggcttggtggacgaacttagcgtt
gacaacatgggcaacgtggttgccatcaaacgtggtaaagagcgcaaacgcgccatgatc
gctgcccaccttgatgaaataggttttattgtcaaccacattgatgaagaaggttttcta
ttttttcaccccctcggtggttttgaccccaaaacactcacttctcaacgggtgattgta
cacggcaaaaaagatgtaattggcgtaatgggttcaaaacccattcacctcatgaaaccc
gaagagcgcaacaaagtagtccccatgaccgattactacatcgatctgggcatgcgcaag
gaggaggtgatcaaaatagtttccatcggtgatccggttacccgcgaacgtgaactcatt
gaaatgggtgattgtgtcaacagcaaatcactggacaatcgagtatcggtgttcatcctc
atagaaacactccgggcattacaaggcgtagaaataccttatgatatatatggtgtcttt
accgttcaggaagaagtaggcctgcgcggagccatttctgctgcccatggcatcaatccc
gattttggttttggcctggatgtcaccattgcctttgatacccccggtgcccaagcgcaa
gaagcggtcaccaaactcggcaaaggagccgggatcaaaatcctggacggcagtgtaatt
tcagattaccgcatggtgcgctacctgaaagagacggctgatacattcaatattccctgg
caacccgagattttaccagctgggggtaccgataccgcgggggtacaacgttatggtaaa
aaaggagcaattgccggggcaatttccatccccttgcgccacattcaccaaaccattgaa
atggccaacaaagccgacattcaacattgtaccgatttgttgattgtggccttgcagcat
ttgcatgaattcaattgggaattccggtag

DBGET integrated database retrieval system