KEGG   Haliscomenobacter hydrossis: Halhy_3743Help
Entry
Halhy_3743        CDS       T01491                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:hhy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Halhy_3743
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halhy_3743
   00052 Galactose metabolism
    Halhy_3743
   00500 Starch and sucrose metabolism
    Halhy_3743
   00520 Amino sugar and nucleotide sugar metabolism
    Halhy_3743
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Halhy_3743
   00524 Butirosin and neomycin biosynthesis
    Halhy_3743
Enzymes [BR:hhy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Halhy_3743
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4726420..4727325)
Genome map
AA seq 301 aa AA seqDB search
MNIGIEIGGTKLQLATGDPATGKIDQIYRYRVDKAQGAQGILAQIDQTLQALPQPPSRIG
IGFGGPVNRQTGVIATSHQIGGWSGFDLNQWIKERFDAPAFIDNDANVAALGEARFGAGE
GYAQVFYITLGSGVGGGMVSSGQLYHGNVPGEAEVGLLQMDRDGNTLESNCSGWALDAKI
RALLPSLPAQSILKQGVGAQQSGEAQFLLPAFNQGDLTAAELLKDYSDTLAWGLSHVVHL
FNPQIIVLGGGVSLIGEALRVRVQEALPKYLVKAFQPGPRIALANLKEEAVLVGALCLLN
R
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaacataggcatcgaaatcggcggcaccaaactacaactggccacaggtgaccctgcc
acaggtaagattgatcaaatctaccgctaccgggtggacaaagcccagggtgcgcagggt
attttggctcaaattgaccaaactttgcaagccttgccgcagccgcccagccgcattggg
atcggctttggcgggcccgtcaaccgccaaacgggggtcatcgctacctcgcaccaaatt
gggggctggtcgggatttgatttaaaccaatggataaaagaacggtttgatgctccggct
tttatcgacaacgatgccaatgtagccgcgctgggtgaagcccgttttggcgcaggggaa
ggttacgcacaggttttttacattactctaggcagtggggtcggcggcggaatggtcagc
agtgggcagctttaccacggcaatgtaccgggggaagctgaggtcgggctgttgcagatg
gatcgcgatgggaacaccctggagtccaattgttcgggctgggccttggacgccaaaatt
cgagctttgttgcccagcttgcccgcacaatcaatactcaaacaaggggtaggagcccag
caatccggggaggcccagtttttattgcctgcattcaatcaaggcgatctcactgccgct
gaactactcaaggactattcggataccctggcctggggcctttcacatgtggtgcatttg
tttaacccacaaatcattgtgctgggtggtggcgtttcgctgattggtgaggcactcagg
gtgcgggtacaggaggcgctgcccaaatatttggtcaaggcgtttcagccggggccgcgg
atcgcgctggcaaaccttaaagaagaggccgtgctggtgggggcattgtgcctgctgaat
cggtag

DBGET integrated database retrieval system