KEGG   Haliscomenobacter hydrossis: Halhy_4207Help
Entry
Halhy_4207        CDS       T01491                                 

Definition
endo-1,4-beta-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
hhy  Haliscomenobacter hydrossis
Brite
Enzymes [BR:hhy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Halhy_4207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5302859..5305633
Genome map
AA seq 924 aa AA seqDB search
MKQLTKNHWLASCFCLLTSYAVVAQNLIPNPGFEAGTGKTFTNWSIFNEISGTFSEAVAN
GEFRSGSRALKGQVTQAGQPWHLQLASDPIPTQSGEEYTFSIWVKGANAGTLIRFSTQPN
ALYSVDYTVSTEWTQLTWTFTANEAMTRIVLDIGAQVNTYYLDDMSLRGPAGGAANCQLL
DNGDFEMYNPSDSTFTGWAYFNQNGGSSFGVATGDNAYDGNAALRAVNAGGIPRWGLQVG
TPAFPTVNGQTYTLNMWIKARVANANFIQFSTRDGNAANEGQYTNSATRISGDWTLVSYT
FTAISDETVITLNLGDETANTYYIDDICVVYPETTDNCLPLNNNGFETYDTGSNTFSGWS
YYNQSNGSSFGVTMDTAKVYSGSKALVARTATNTLSYQLQMASPSFYTLSGGTYRFKIWI
KADSANVNTIQFSLRNAASPFNSETQYTTSASRIGNEWMQVTYEFKAFSPRSLVTLNLGG
AVANTYYIDEVCLEVVCGTSYAAPETQVPIATGKPKFLGNVYAGHALPDFEKYFNQVTPE
NSGKWASVEVQRDSFNWAALDQARQFAKAQNFPFRFHVMVWGAQQPTWLENLPQAEQVAE
IKEWFAAVSTRYSGENAPEYLEVVNEPLNQPPFYKAALSSLNAELNTEAGEYDWIVNAFK
LAKQYFSAETQLMINEYGIENTPSLNSRYADIIRLLKTDDLIDVVGMQGHTFSTKKYGGT
YAGLNNNLRSNLDNIAQLGLPIQITELDIEGDMYFDANGEPQDGGTTAQKDSFQLAEYQR
IFDIYWNHPSVIGITLWGWRPGLWQNDAAAYLLDPCTGQERPALQWLNTAIRASSPPVNI
PTSLKEIESAIPLRVYPTVVQNELTIEGLAQNRGLVQVFDLQGRLVKSIAHPLNDDRITV
NVGALPRGLYVIRAGRAVQKIIKQ
NT seq 2775 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaattgaccaaaaaccattggttagcaagctgcttttgtttgctaacgagctat
gcggttgtagctcaaaatctcattcctaacccgggctttgaagcaggtacgggcaaaact
tttaccaattggagtattttcaacgaaatcagcggcactttttcggaagctgttgccaac
ggtgaattcagaagcggcagcagggccttgaaagggcaagtgacgcaagctggccagcct
tggcatttgcagttggcgagtgatccgattcctactcagtcgggtgaggaatataccttt
tccatttgggtgaagggcgcgaatgcaggcacgctgattcggttttctacccaaccaaac
gctttgtattcagtagattataccgtaagtactgaatggacacaattgacctggaccttt
acggcgaatgaggcgatgacgcgaatcgtactggacattggtgcacaagtgaacacgtat
tacctggacgacatgtctttgaggggccctgcgggtggcgcagcaaattgccaattgctt
gacaatggcgattttgaaatgtacaatccaagtgatagtacattcacgggctgggcttat
ttcaaccaaaatggcggaagcagctttggcgtagccacgggcgataacgcctatgatggc
aatgctgctttgcgggctgtcaatgctggcgggattcccaggtggggattacaagttgga
acgcccgcttttcctaccgtgaatggacaaacctacaccttgaatatgtggatcaaagca
cgggtagctaatgccaatttcatccagttttccaccagagatgggaacgcggcgaatgaa
ggacaatacaccaattctgcaactaggataagtggggattggacgctcgtttcttatacg
tttacggcgattagtgatgagacggtgattaccttaaatcttggcgacgaaactgcaaat
acctattacattgacgacatttgtgtggtctatccagaaacaaccgacaactgtttgccg
cttaataacaatggttttgaaacctatgataccgggagcaatacattcagcggttggagc
tattacaaccagagcaacggtagttcttttggcgtgacgatggatactgcgaaggtatac
agcggttccaaggcgctagttgcccgtactgccaccaacaccttaagctatcagctgcaa
atggccagtccttctttttataccttatccggcggtacctaccgcttcaagatatggatt
aaagcagacagcgcgaatgtcaacacgattcaattttccctgagaaacgcggctagtccc
ttcaattcagaaacgcaatacactacctctgccagtagaattggtaatgaatggatgcag
gtaacttacgaattcaaagcgtttagccctcggtcgcttgtcaccctcaatctgggcggt
gccgtggccaatacgtattacatcgatgaggtctgtctggaggtggtatgtggcacaagc
tacgccgcgccagaaacccaagtaccgattgcgacgggcaagccaaagtttttaggaaac
gtttacgctggtcatgcgttgccagactttgaaaaatatttcaatcaagtaactccggaa
aactccggtaaatgggcctcggtagaagtacaaagagattcgttcaactgggcagcgctg
gatcaggcccggcagtttgcgaaagcccagaatttccctttccggttccacgtaatggta
tggggcgcacaacaacccacctggttagaaaatttgccgcaagcggaacaagtggcagaa
atcaaagaatggtttgctgccgtgtccactcgttacagcggcgaaaacgctcccgaatac
ctggaagtagtgaacgagcccttgaatcagccacctttttacaaagctgctttgagttcc
ttaaacgcagaactaaacactgaagctggcgaatacgactggattgtgaatgcttttaaa
ttggccaaacaatatttctctgcggaaacacaactgatgatcaatgaatatgggattgaa
aacacgcctagcctcaatagccgttacgccgatatcatccgtttgctgaaaacagatgac
ttgatagatgtggttggcatgcaaggccataccttcagtaccaaaaaatacggaggtact
tacgcaggattgaataacaacctaagaagcaatctggataacatagcgcagttgggactg
cccattcagattacggaactggatattgaaggcgatatgtactttgatgcgaatggagaa
ccacaagacggggggacaactgctcaaaaagacagcttccaactcgcggaataccagcga
atttttgacatctactggaaccatccctcggttattggcatcacgctgtggggctggcga
ccaggcctgtggcaaaatgacgccgcagcttatctgcttgatccttgtacggggcaggag
cgacctgctttacagtggctgaataccgcgattagggcctcctctccacccgtcaatatt
cccaccagcttaaaggagatcgagtcagccattccgttaagggtgtatcctacggtggtt
caaaacgagttgaccatcgaggggctggctcaaaatagagggctcgttcaggtttttgac
ctccaggggcgcttggtaaaatcgattgctcatcccttgaatgacgacagaattacggtc
aatgtgggggcattaccgagagggctatacgtcatacgagcaggtagagcggttcaaaaa
attatcaaacaatag

DBGET integrated database retrieval system