KEGG   Haliscomenobacter hydrossis: Halhy_4227Help
Entry
Halhy_4227        CDS       T01491                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:hhy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Halhy_4227
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Halhy_4227
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Halhy_4227
Enzymes [BR:hhy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Halhy_4227
Exosome [BR:hhy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Halhy_4227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5332380..5333486)
Genome map
AA seq 368 aa AA seqDB search
MKKLLICALAMLLCLPVFSQKKAKGAASPAVAVPKAKNVILLIGDGMGLTHISAGMYFNN
NQSNFERFPVAGLQKAYSASDLITDSAAGATAFASGIKTYNGAIGVNTDSMPVKTILEEA
EERGLATGMVVTSTLTHATPASFVAHVRNRKFDEEIATFFLKTEIDFLAGGGKKFFEQRA
ADGRNLYQELKDKGYQVSDFTQKNASSLAPDPSKNFIYFSADADPAKASEGRSYLAPLSV
LAANHLKKRSEKGFFLMVESSQIDWGGHNNESDYIVSEVVDFDQTIGKILDFAAADGETL
VIVTADHETGGYAISPGSELGKIRGAFTTKGHTAQLIPVFAFGPGAELFAGVYENTAIYV
KMRQVLGF
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactcttgatatgcgcactggccatgctgctgtgtttgccagttttcagccaa
aagaaagcaaaaggtgcagcaagtccggctgttgcagtgcccaaagccaaaaatgtcatt
ttgctcatcggagatggcatgggactgacccatatttcggcggggatgtatttcaacaac
aaccaaagcaattttgaacgtttccccgtggctggtttgcaaaaagcctattcagccagt
gatttgattaccgactccgcagccggggcgactgcctttgccagtggcatcaaaacctac
aacggcgccatcggtgtcaatacggacagcatgcccgtaaaaaccattctggaagaagcc
gaagagcgcggtcttgctacgggtatggtggtcacttctaccctcacccacgctacccca
gcctcctttgtggcccacgtgcgcaaccgcaagttcgatgaagaaattgccacttttttc
ctcaaaaccgaaattgattttttggccggaggaggcaaaaagttcttcgaacagcgcgcc
gccgatggccgaaatctgtaccaggaactcaaagacaaaggttatcaggtgagtgatttc
acccaaaagaacgccagcagtttggcacccgatccaagcaaaaatttcatctacttcagc
gccgatgccgatccagccaaggcatctgaaggccgcagctatttggcaccactcagtgtt
ttggcggccaatcatttgaaaaaacgctccgaaaaaggttttttcctaatggtggagagt
tcacaaatcgattggggtggccacaacaatgaatcggattacatcgtgagcgaagtggta
gattttgatcaaaccattggcaaaattctggactttgccgccgccgacggcgagaccctg
gtcatcgtcactgccgaccacgaaacggggggctacgccatcagtcccggatcagaactg
ggtaaaatccgaggggcatttaccaccaaagggcataccgcgcaattgattccggttttt
gcctttggcccaggtgctgagttgtttgcgggggtgtatgagaatacggcgatatatgtg
aaaatgaggcaggtgttggggttttag

DBGET integrated database retrieval system