KEGG   Haliscomenobacter hydrossis: Halhy_4265Help
Entry
Halhy_4265        CDS       T01491                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
hhy  Haliscomenobacter hydrossis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hhy00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Halhy_4265
DNA repair and recombination proteins [BR:hhy03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Halhy_4265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5372501..5373112
Genome map
AA seq 203 aa AA seqDB search
MNFSSKLLEDAVNAFASLPGIGKKTALRLVLHLVNREVDTVDQFGDAIVKMRREIKSCKV
CHNLSDEELCMICRDARRDHQVVCVVENIRDVMAIEDTGQYRGLYHVLGGVISPLEGVGP
SELTIDSLVQRITNNEVKEIVMAISPTIEGETTIFYISKRLKDLHVNISTIARGVSFGGE
LEYADELTLGRSIVARIPYQRQE
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaacttctcatccaaacttcttgaagacgccgtaaacgcatttgcgagcctacctggc
attggtaaaaagaccgcattgcgattggttttgcacctggtcaaccgcgaagtagatacg
gtggatcagtttggtgacgccattgtaaaaatgcgccgtgaaatcaaatcctgcaaagtt
tgccacaacctgtccgacgaggaattgtgcatgatttgccgcgatgcccgccgcgatcac
caggtggtttgtgtggtagaaaacatccgcgatgtcatggccatcgaagatacgggtcaa
taccggggtttgtaccacgttctgggcggggtcatttctccgctggaaggggtcggcccc
tctgaactcaccatcgatagcctggtacaaagaattaccaacaacgaggtcaaagaaatc
gtgatggccattagtccgaccatcgaaggggaaaccaccattttttacatctccaaacgt
ttaaaagacctgcacgtgaacatcagcaccatcgcccgtggggtatccttcggcggtgag
ctggaatacgccgacgaacttacgctgggtaggtcgattgtggcccggataccgtatcag
agacaagaatag

DBGET integrated database retrieval system