KEGG   Haliscomenobacter hydrossis: Halhy_4396Help
Entry
Halhy_4396        CDS       T01491                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:hhy00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:hhy00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5553959..5555041
Genome map
AA seq 360 aa AA seqDB search
MNSKQLVRNKAWLDNKNERPWMLPNRCLVFCLFLASASSLFCQSRIVVANDGSGDFRSIQ
AAINSLPAESTVWREVYIRNGNYPEKIFIEKNKITLTGQTVAGVVITVSQARDCWRCEHP
DDWGAATMNLRAQDITLQNLTVINSYGFNAKGDSTITCTNEANAAKVVRKDGHQFALRSM
PGCTRLSAINCVFRALGGDTVSPWDVDQGMYYFRNCVMEGGVDFYCPRGWAYAEDCTFIC
HNLSAAIWHDGSLHESSKTVLKNCTFNGDPGFKLGRFHRESQFYLLQCRFAKEMADADIY
WAQSGPGTPLWGKRVFYYRCKRSGGNYTWHQDNLGSEVKAKEINVSWTFDGRWTPPGSGK
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
gtgaatagcaagcaactagtacgcaacaaggcatggttggacaacaaaaatgagagacca
tggatgttgcccaaccgctgtcttgttttttgcctttttctggcatcggccagctcgctt
ttttgccaaagtcgaatagtggttgccaacgatggatcgggcgatttccgcagcatccag
gccgccatcaacagtttacctgctgaatctacggtctggcgcgaggtttacatccgcaat
ggcaactacccggaaaaaatcttcatcgaaaaaaacaagatcacccttacagggcagacg
gtggcgggcgtcgtcattaccgtgagccaggcgagagattgttggcgttgtgagcatccc
gatgattggggtgcggccaccatgaacctgcgggcgcaggacatcaccttacaaaacctg
accgtcatcaacagttacggcttcaatgccaaaggtgatagtaccatcacctgcaccaac
gaggccaacgcagctaaagtggtgcgcaaagatggacaccagtttgccctgcgcagtatg
ccgggttgtacccgtttgtcggccatcaattgtgtgtttcgcgctttgggtggagataca
gtcagcccctgggacgtagatcagggcatgtactatttccgcaactgcgttatggaaggt
ggggtagatttttattgcccgaggggttgggcttacgccgaagattgtacctttatttgc
cacaacctcagcgccgccatttggcacgatggatcgttgcacgaaagttcaaaaacggtg
ctcaaaaactgcacattcaacggtgatccgggttttaaactgggccgttttcaccgcgaa
tcgcagttttatttgttgcaatgccgctttgccaaagaaatggccgacgccgatatttac
tgggcacaatcgggtcccggcacaccattgtggggaaaaagggtattttactaccgctgc
aaacgcagtggcggcaattatacctggcatcaggacaacctggggagtgaggtgaaagcc
aaagaaataaacgtatcctggaccttcgatggacgttggacacctccaggatcgggaaaa
taa

DBGET integrated database retrieval system