KEGG   Haliscomenobacter hydrossis: Halhy_4396Help
Entry
Halhy_4396        CDS       T01491                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hhy00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Halhy_4396
   00500 Starch and sucrose metabolism
    Halhy_4396
Enzymes [BR:hhy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Halhy_4396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5553959..5555041
Genome map
AA seq 360 aa AA seqDB search
MNSKQLVRNKAWLDNKNERPWMLPNRCLVFCLFLASASSLFCQSRIVVANDGSGDFRSIQ
AAINSLPAESTVWREVYIRNGNYPEKIFIEKNKITLTGQTVAGVVITVSQARDCWRCEHP
DDWGAATMNLRAQDITLQNLTVINSYGFNAKGDSTITCTNEANAAKVVRKDGHQFALRSM
PGCTRLSAINCVFRALGGDTVSPWDVDQGMYYFRNCVMEGGVDFYCPRGWAYAEDCTFIC
HNLSAAIWHDGSLHESSKTVLKNCTFNGDPGFKLGRFHRESQFYLLQCRFAKEMADADIY
WAQSGPGTPLWGKRVFYYRCKRSGGNYTWHQDNLGSEVKAKEINVSWTFDGRWTPPGSGK
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
gtgaatagcaagcaactagtacgcaacaaggcatggttggacaacaaaaatgagagacca
tggatgttgcccaaccgctgtcttgttttttgcctttttctggcatcggccagctcgctt
ttttgccaaagtcgaatagtggttgccaacgatggatcgggcgatttccgcagcatccag
gccgccatcaacagtttacctgctgaatctacggtctggcgcgaggtttacatccgcaat
ggcaactacccggaaaaaatcttcatcgaaaaaaacaagatcacccttacagggcagacg
gtggcgggcgtcgtcattaccgtgagccaggcgagagattgttggcgttgtgagcatccc
gatgattggggtgcggccaccatgaacctgcgggcgcaggacatcaccttacaaaacctg
accgtcatcaacagttacggcttcaatgccaaaggtgatagtaccatcacctgcaccaac
gaggccaacgcagctaaagtggtgcgcaaagatggacaccagtttgccctgcgcagtatg
ccgggttgtacccgtttgtcggccatcaattgtgtgtttcgcgctttgggtggagataca
gtcagcccctgggacgtagatcagggcatgtactatttccgcaactgcgttatggaaggt
ggggtagatttttattgcccgaggggttgggcttacgccgaagattgtacctttatttgc
cacaacctcagcgccgccatttggcacgatggatcgttgcacgaaagttcaaaaacggtg
ctcaaaaactgcacattcaacggtgatccgggttttaaactgggccgttttcaccgcgaa
tcgcagttttatttgttgcaatgccgctttgccaaagaaatggccgacgccgatatttac
tgggcacaatcgggtcccggcacaccattgtggggaaaaagggtattttactaccgctgc
aaacgcagtggcggcaattatacctggcatcaggacaacctggggagtgaggtgaaagcc
aaagaaataaacgtatcctggaccttcgatggacgttggacacctccaggatcgggaaaa
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system