KEGG   Haliscomenobacter hydrossis: Halhy_4491Help
Entry
Halhy_4491        CDS       T01491                                 

Definition
porphobilinogen synthase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:hhy00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5680110..5681171
Genome map
AA seq 353 aa AA seqDB search
MLKRPRRNRKTAAIRGMVRETQLSVENLVQPLFLVSKETSREPVKSLPNTYRLGIRETLK
EVEDSLNLGITNFILFPVVPDQYKDKFATYGHHEDNFYLKITAEIKRRFPETCLISDVAM
DPYSTDGHDGLVRDGKIINDETLPILAKMAVAQAAAGFDLLGPSDMMDGRVGYMRQALDA
AGYTDTGIMAYTAKYASAFYGPFRQALDSAPKAGDKKTYQMDPANQREALIEAALDIEEG
ADFIMVKPALNYLDVISLLKNNTETPVSAYHVSGECAMLIAAAEKGWIDLDQAVQETLMC
LRRAGSDVIITYFTKHYARMMKQGYMPEERKEPKTHARKHSTKMPAFITNYKI
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaaagacctagacgtaatcgaaaaactgctgcaattagaggcatggtacgtgaa
acacagctttccgtagaaaacctcgtgcagcccctcttcctggttagcaaagagacctca
cgtgaaccggtcaaatctttgcctaacacctaccgccttggcattcgtgaaaccttgaaa
gaagtggaagattccctgaacctgggcatcaccaatttcattctgtttcccgtcgtgcca
gaccagtacaaagacaagtttgctacttacggtcatcatgaggacaatttttacctcaag
attactgcggagatcaaacgccgttttcccgaaacctgtttgatcagcgatgttgccatg
gatccttacagcacggacggccacgacggcctggtgcgcgatggcaaaatcatcaatgat
gaaacgctcccaatcctggccaaaatggcggtagcccaggctgctgccggattcgatttg
ctgggcccatccgacatgatggacggcagagtagggtacatgcgccaagccttggatgcc
gcaggctataccgacacggggattatggcctacacggccaagtacgccagtgcgttttat
ggccccttccgccaggcgctggattcagcccccaaggcaggagacaagaagacttaccaa
atggatccggccaaccaaagagaagccctgattgaggcggctttggacatcgaagaagga
gcggacttcattatggtaaaaccggccttgaactacctggatgtcatcagtttgttgaaa
aacaataccgaaactcccgtatcagcgtaccacgtgagtggggaatgcgcgatgctcatt
gccgctgccgagaaaggttggattgatctggatcaagctgtacaagaaacgctgatgtgt
ttgcgtcgtgcgggttcagatgtaatcattacttacttcaccaagcactacgcgcggatg
atgaagcaaggttacatgccagaagaacgcaaagaaccgaaaactcatgcgcgcaagcat
tctaccaaaatgcctgcgtttataacgaactacaagatttga

DBGET integrated database retrieval system