KEGG   Haliscomenobacter hydrossis: Halhy_4712Help
Entry
Halhy_4712        CDS       T01491                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
hhy00860  Porphyrin and chlorophyll metabolism
hhy01100  Metabolic pathways
hhy01110  Biosynthesis of secondary metabolites
hhy01120  Microbial metabolism in diverse environments
Module
hhy_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:hhy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Halhy_4712
Enzymes [BR:hhy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Halhy_4712
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Nitro_FeMo-Co
Motif
Other DBs
NCBI-ProteinID: AEE52546
UniProt: F4KWR3
Position
5968012..5968689
Genome map
AA seq 225 aa AA seqDB search
MTIFISRQLSPDSPFYHLLPADKVKIIGESLVAFEVLEFGTLPEVDWCFFSSRNAVHFFF
QGLKAAGLNLPSAVKLAVLGDGTAKALKQQGHVADFAGNGDPQTVGEAFGIVAAGQSVLF
PRAAQSRESIQKILADAVTIFDLVVYNNVPRKDFVLPAADVLVFTSPLNAQAYFSCYPQQ
DGQTTVAIGQTTLQALTELGIKNVHTAATPTEEVLAEICKSQLAI
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcttcatctcccgtcaactaagcccggacagccccttctaccatctacttccc
gccgataaggtaaagatcattggggagtctttggttgctttcgaagtactggagttcggt
actttgccggaagtagattggtgtttcttttcaagccgcaatgccgtacatttttttttt
caaggcctaaaagcggcgggactcaatttaccttcggctgtaaaactggctgtgttgggt
gacggaacggccaaggctttgaaacaacaaggccatgttgccgattttgctgggaatgga
gacccccaaacggtaggagaggcctttggcatcgtggcggcaggtcaaagcgttttgttt
ccccgggccgcccaatctcgtgagagcattcaaaaaatattggctgatgctgtaaccatc
ttcgatttggtggtttataataatgtaccccgtaaggattttgtattgccggcagcggat
gtgctggtgtttaccagtccgctcaatgcgcaggcgtatttttcgtgttatccccaacag
gatggacaaactacggtagccattgggcaaactaccttgcaggccctgaccgaactgggt
ataaaaaatgtacacacggcagctactcccacggaggaagtactggcagaaatttgtaaa
tcacagcttgcgatatga

DBGET integrated database retrieval system