KEGG   Haliscomenobacter hydrossis: Halhy_4779Help
Entry
Halhy_4779        CDS       T01491                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit alpha
  KO
K01902  
succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hhy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Halhy_4779
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Halhy_4779
   00640 Propanoate metabolism
    Halhy_4779
   00660 C5-Branched dibasic acid metabolism
    Halhy_4779
Enzymes [BR:hhy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Halhy_4779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6037322..6038194
Genome map
AA seq 290 aa AA seqDB search
MAVLVNKDSRIIVQGFTGKEGTFHATQMLEYKTNLIGGVTPGKGGTTHLDKPVWDTVEQA
VKLGGADVSVIFVPPAFAADAIMEAADAGIKVIICITEGIPVQDMVKVKAYIATRDCRLI
GPNCPGVITPDEAKCGIMPGFIHKKGTIGIVSRSGTLTYEAVDQVTKAGLGQSTCIGIGG
DPIVGTSTKEAVELLMNDPETEAIIMIGEIGGGMEAEAARYVQAFGTKPVVGFIAGQTAP
KGRKMGHAGAIIGGDDDTAEAKMKILEECGIHVVKSPADLGTTVLKALGR
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggcggttctcgttaataaggattcccggatcattgtacagggattcaccggcaaggaa
ggtacgttccatgccacccaaatgttggaatacaagacaaatttgattggtggggttact
cccggcaaaggaggaaccacccatttggacaagccagtttgggataccgttgagcaagcc
gtgaaattgggcggtgctgacgtatccgtcatctttgtaccccctgcttttgctgccgat
gccattatggaagcagccgacgcgggcatcaaagtcatcatctgcatcaccgaaggtatt
ccggtacaagacatggtgaaagtgaaagcctatatcgccacccgcgattgccgcttgatc
ggccccaactgccccggtgtcatcacgcccgatgaagccaaatgtggcatcatgcccggg
ttcatccacaaaaaagggaccattggcatcgtttcccgctccggtacattgacctatgaa
gccgtagatcaggtgaccaaagctggcctgggacaatcgacctgtatcggtattggtgga
gaccccatcgtgggcacttccaccaaagaagcggttgaactgctgatgaacgaccccgaa
accgaagccatcatcatgattggtgaaattggtggaggcatggaagctgaagcagcacgt
tacgtacaagcttttggtaccaagccggttgtaggatttatcgcaggccagacggcgcct
aaaggccgtaaaatggggcacgcgggtgccatcattggtggcgacgatgacactgctgag
gccaagatgaaaatcctggaagagtgtggcattcacgtcgtgaaatctccagctgacttg
ggaactaccgtgttgaaagcactgggaagataa

DBGET integrated database retrieval system