KEGG   Haliscomenobacter hydrossis: Halhy_4829Help
Entry
Halhy_4829        CDS       T01491                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:hhy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Halhy_4829
Enzymes [BR:hhy01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Halhy_4829
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6105270..6106112
Genome map
AA seq 280 aa AA seqDB search
MLYPQTTLNCAGRLLDLSRPVIMGIINVTPDSFYAGSRFTELTDILQQAEQMLSEGAQIL
DIGGMSSRPGARIITAEEEMHRVAPVIQALTQQFPEAIISLDTVYAHSVRAGYDLGVGLI
NDISAGRLDPAMYPTVAELGLPYVLMHMQGQPGTMQSNPVYTDVVTEVLDFFIAEVGKLR
ALGVKDIVLDPGYGFGKTIAHNYQLLKNMHVFRMLDAPLLAGLSRKSMIYCFLNIEPEQA
LNGTTALHMIALQQGAKLLRVHDVKPAAEVIKLWEMLDNE
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgttgtacccacaaaccaccctcaactgcgctggccgcctcctggatctttcccgtccg
gtcattatgggcatcatcaatgtgacgccagatagtttttatgcgggtagtcgattcacg
gaattaaccgatattctgcaacaagcggagcagatgttgagtgaaggggcgcaaattttg
gacattggggggatgtcttcgcggcccggagcgcgcatcatcacggcagaggaggagatg
catcgggtggcacccgtgattcaggctttgacgcaacagtttccggaggcgattatttct
ctggacacggtgtatgctcattcagtacgggcgggttatgatttgggcgtaggactgatc
aatgatatctctgctggtcgcctcgatccagccatgtatccaacggtagcggaactgggt
ttgccgtatgtactcatgcacatgcaaggacaacctggtaccatgcaatccaatcctgta
tataccgatgtggtgaccgaagtgctggattttttcatcgctgaagtgggaaaattgcgg
gctttgggggtgaaagacatcgtattggatcccgggtatggttttggaaaaaccattgcc
cacaattaccagctgttgaaaaatatgcatgtgtttcgaatgctggatgccccacttttg
gcaggattatcccgcaaatcgatgatttattgttttttgaatatcgaacctgaacaggca
ctgaacggtacgaccgcactgcacatgatcgccttgcaacaaggagcaaaactcctgcgc
gttcacgatgtaaaaccagccgcggaagtgattaaattatgggaaatgcttgataatgaa
tag

DBGET integrated database retrieval system