KEGG   Haliscomenobacter hydrossis: Halhy_4927Help
Entry
Halhy_4927        CDS       T01491                                 

Definition
NAD-dependent epimerase/dehydratase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
hhy  Haliscomenobacter hydrossis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6264164..6265210)
Genome map
AA seq 348 aa AA seqDB search
MQVLVTGANGFIGCHLCQALHDKGYAVKALVRTTSDLRSLAKLEVDICYGDILQAETLEK
AAQGCDFLFHVAGVFAYSGTPAHELINEAKRGIIHVLEAASKARVKRVILTSSSVTLGAD
AKKNIRDELSTDTLDDATAYVMAKKMQESTAVEYAAQLGLDLVTVHPTLTVGGNDYGLTE
SNHAIVSYLQDPFKTTWIGGCNMVAVSDVAAGHILLAEKGKSGERYILGSENLEWAEVHK
LISQLCGLPGPYLKAYHTSAYLGSIFHEALGFLTQQRPASTREQARMVGNYYWYSHEKAA
RLGYKPIPTKAALVKAISWLVASTHIPASVRASLQLSKEVFEYRALHP
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgcaagttctcgtcacgggcgcaaacggatttattggatgtcatctttgtcaagcattg
cacgacaaaggttacgctgttaaagccctggtacgtacgacttctgatttgcgcagcctg
gccaaacttgaggtggacatttgttatggggatatcctgcaagctgaaaccctggaaaag
gctgcgcagggctgtgattttctatttcatgtggccggcgtatttgcctattccggcacc
cctgcccatgagctcatcaacgaggccaaacgaggcatcatccatgtactggaggcggct
tccaaagcccgggtcaagcgggtgatccttacttcatcttccgtcaccctgggcgctgac
gccaaaaaaaacatccgcgacgagttgtctaccgacaccctggacgacgccaccgcgtac
gtgatggccaaaaaaatgcaggaatcaaccgctgttgaatacgccgcccaattgggtctg
gatctcgttaccgtacaccctaccctcacggtggggggcaatgattacggcctcacggaa
agcaatcacgccatcgtcagttacctccaagatccctttaaaaccacctggattggtggc
tgcaacatggtggccgtaagcgatgtggctgcggggcatatcctgctggccgaaaaaggc
aaaagtggggaacgttatatcctcggcagcgaaaatttggagtgggccgaagtacataaa
ctaatttctcaactttgtggcctgccgggaccctacctcaaggcctaccacacctcggct
tatttggggtccatcttccacgaggccctgggatttttgacccaacaaaggcccgcctct
acccgggagcaagcccggatggtgggcaattattattggtacagccatgaaaaagccgct
cgactcgggtacaaacccatcccgacaaaagcagcattggtcaaagccatttcctggctg
gttgcatcaacacatattcctgcttcggtaagggcaagcctgcaattgtcgaaggaagtt
tttgaataccgcgcgcttcatccataa

DBGET integrated database retrieval system