KEGG   Haliscomenobacter hydrossis: Halhy_4989Help
Entry
Halhy_4989        CDS       T01491                                 

Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hhy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Halhy_4989
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Halhy_4989
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Halhy_4989
Enzymes [BR:hhy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Halhy_4989
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(6329765..6330538)
Genome map
AA seq 257 aa AA seqDB search
MNRIEKLFQNKDKNVLNIYFTAGYPGVNDTEEIILSLEKAGVDLVEVGMPYSDPLADGPT
IQESGTAALENGMTLPLLFEQLAAVRKKTEMPLIMMGYFNQVMQYGERAFFEKAAEVGVD
GLILPDLPLFEYETYFKDIVESLGLAVSFLITPQTEPERIRKIDELTHGFIYMVSSSSIT
GAKSDITDTQLAYFNRINDMQLKNKRLIGFGISNHETFATACQYANGAIIGSAYIKALTH
NPKVAESTAEFVEMVLG
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaatcgaaaaattgttccaaaacaaggacaaaaacgtactcaacatatacttc
accgcgggttatccgggagtgaatgacaccgaagagatcatcctttcgctcgaaaaagcg
ggcgtggatttggtggaagtgggcatgccttattccgacccactcgccgacgggccaacc
atccaggaaagtggaaccgcagcgctggaaaacggcatgaccttgcccctgctgtttgaa
caactagcggcagtgcgcaaaaaaaccgaaatgcccctgatcatgatgggctatttcaac
caggtgatgcaatatggcgaacgggccttttttgaaaaagcagccgaagtgggcgtcgat
ggcttgatcttgccggatttacccttgttcgagtatgaaacgtatttcaaagacatcgtg
gaatcgctggggctggcggtgagtttcctgatcaccccccaaacggaacccgagcgcatc
cgcaagatagatgaactgacgcacggtttcatctacatggtgtcgagttcgtccatcacc
ggcgccaaaagtgacatcaccgatactcaattggcctatttcaaccgcatcaacgacatg
caactgaaaaacaaacgcctgatcgggttcgggatttcgaatcacgagacttttgcaacg
gcttgccagtacgccaatggggcgattattgggagcgcgtacatcaaggcactaacgcac
aatccgaaggtggcggagagtacggcggagtttgtggagatggtgttggggtag

DBGET integrated database retrieval system