KEGG   Haliscomenobacter hydrossis: Halhy_4989Help
Entry
Halhy_4989        CDS       T01491                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hhy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Halhy_4989
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Halhy_4989
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Halhy_4989
Enzymes [BR:hhy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Halhy_4989
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6329765..6330538)
Genome map
AA seq 257 aa AA seqDB search
MNRIEKLFQNKDKNVLNIYFTAGYPGVNDTEEIILSLEKAGVDLVEVGMPYSDPLADGPT
IQESGTAALENGMTLPLLFEQLAAVRKKTEMPLIMMGYFNQVMQYGERAFFEKAAEVGVD
GLILPDLPLFEYETYFKDIVESLGLAVSFLITPQTEPERIRKIDELTHGFIYMVSSSSIT
GAKSDITDTQLAYFNRINDMQLKNKRLIGFGISNHETFATACQYANGAIIGSAYIKALTH
NPKVAESTAEFVEMVLG
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaatcgaaaaattgttccaaaacaaggacaaaaacgtactcaacatatacttc
accgcgggttatccgggagtgaatgacaccgaagagatcatcctttcgctcgaaaaagcg
ggcgtggatttggtggaagtgggcatgccttattccgacccactcgccgacgggccaacc
atccaggaaagtggaaccgcagcgctggaaaacggcatgaccttgcccctgctgtttgaa
caactagcggcagtgcgcaaaaaaaccgaaatgcccctgatcatgatgggctatttcaac
caggtgatgcaatatggcgaacgggccttttttgaaaaagcagccgaagtgggcgtcgat
ggcttgatcttgccggatttacccttgttcgagtatgaaacgtatttcaaagacatcgtg
gaatcgctggggctggcggtgagtttcctgatcaccccccaaacggaacccgagcgcatc
cgcaagatagatgaactgacgcacggtttcatctacatggtgtcgagttcgtccatcacc
ggcgccaaaagtgacatcaccgatactcaattggcctatttcaaccgcatcaacgacatg
caactgaaaaacaaacgcctgatcgggttcgggatttcgaatcacgagacttttgcaacg
gcttgccagtacgccaatggggcgattattgggagcgcgtacatcaaggcactaacgcac
aatccgaaggtggcggagagtacggcggagtttgtggagatggtgttggggtag

DBGET integrated database retrieval system