KEGG   Haliscomenobacter hydrossis: Halhy_4990Help
Entry
Halhy_4990        CDS       T01491                                 

Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
hhy00260  Glycine, serine and threonine metabolism
hhy00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hhy01100  Metabolic pathways
hhy01110  Biosynthesis of secondary metabolites
hhy01130  Biosynthesis of antibiotics
hhy01230  Biosynthesis of amino acids
Module
hhy_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hhy00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Halhy_4990
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Halhy_4990
Enzymes [BR:hhy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Halhy_4990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEE52818
UniProt: F4L186
Position
complement(6330758..6331930)
Genome map
AA seq 390 aa AA seqDB search
MIAVDEKGYYGEFGGAYIPEMLWPNVQELRENYLNLVAEPEFQREFQSLLRDFVGRPTPL
YLAQRLSEHYGVSIYLKREDLCHTGAHKINNTIGQILLAKRLGKTRIIAETGAGQHGVAT
ATVCALMGLPCIVYMGEVDIERQAPNVARMKMLGAEVRPATSGSRTLKDATNEAIRDWIN
NPVDTHYIIGSVVGPHPYPDMVARFQSVISEEIKWQLEEHTGKDHPDAVIACVGGGSNAA
GAFYHYLNDTRVRLIAVEAAGEGIHSGKSAATSVLGTKGVIHGSRTLLMQTADGQIVEPH
SISAGLDYPGIGPLHAHLISSGRAEAISITDEESLEAALFLSRQEGIIPALETAHAISAL
RVMEYKPSDVLVLCLSGRGDKDLATYMKYL
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgatagcggtagacgaaaaaggatattatggcgaatttggtggcgcgtacatcccggag
atgctctggcccaatgtgcaggaattgcgggagaactacctgaacctggtggccgaacct
gaatttcagcgcgagtttcaatccttgttgcgcgactttgtaggccgccctaccccactc
tacctggcccagcgcctttcggagcactacggggtaagcatttatctcaagcgcgaagac
ttgtgccatacgggtgcgcacaaaatcaacaacaccatcgggcaaatcctgctggccaaa
cgcctgggcaaaacccgcatcattgctgaaaccggcgcggggcagcacggcgtagccaca
gctacggtttgtgcactgatgggcctcccctgtatcgtgtacatgggcgaggtggacatt
gaacgacaggcccccaatgtggcgcggatgaagatgctcggcgctgaagtacgtccagca
acgagcggcagccgcaccctcaaagacgccaccaacgaggccatccgcgactggatcaac
aatccggtcgatacccattacatcatcggttccgtcgtaggacctcacccctaccccgat
atggtggcccgcttccaatcggtgatcagtgaagaaatcaagtggcagttggaagagcat
acgggtaaagaccaccccgatgccgtgattgcttgtgtgggcggtggcagcaatgctgcg
ggtgctttttaccactatctcaacgatactcgggtgcgcctgatcgccgtcgaagcagcg
ggtgaaggcatccacagtggcaaaagcgcggctaccagcgtactgggcaccaagggtgtc
atccacggcagccgtaccttgctgatgcaaaccgcagatggacaaattgtagaaccccac
tccatctcagcgggtttggattaccccggcattggccccctgcacgcccacctgatcagc
agtggtcgtgccgaggcgatcagcatcaccgatgaggaatcgctggaggctgcgttgttc
ctttcccgacaggaaggcatcattccggccctggaaacagcacacgcgatttcagcctta
cgggtcatggaatacaagcctagcgacgtgctggtgctgtgtttgtccgggcgcggggat
aaggatttggcgacttacatgaaatacctttaa

DBGET integrated database retrieval system