KEGG   Haliscomenobacter hydrossis: Halhy_5073Help
Entry
Halhy_5073        CDS       T01491                                 

Definition
signal transduction histidine kinase with CheB and CheR activity
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:hhy02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:hhy02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6442862..6446812)
Genome map
AA seq 1316 aa AA seqDB search
MKSNPLPDKKKARSKKGTSAPANPSANEGPKLKTRNKKVQDKPALPPAEPEGPHPFPVVA
IGASAGGLEAITQLLQNLSPNTGMAFIYVQHLSPDHKSMLSPILSKATAMPVQDIEDMDK
MQADQVYVMPYNRDIEVVDGHIKLIPRPQNKTSNLSIDVLFSSLAETHKENVIGIVLSGS
ASDGTRGLKEIKLAGGITFAQDDSAKFSSMPQSAIAEGVVDFIFSPQKIAQELNWMSKHP
LVKRTGVKPAPEDAIANSNPNLKNILQLIHKKNGVDFSHYKMSTIKRRMLRRMVIHKMDT
LKHYNELLAQKPAEVDLLYQDLLINVTDFFRDAEVFKVLASSVLSSLLKSKKSGETLRIW
VVACATGEEVYSIAMILFELQNQQNHHIPFQIFASDLSAQAISTARVGEYSAHELIHVSP
QRMQQFFTKSRDKYRINKTLRDVCVFAEHNILSDPPFSRMDFISCRNLLIYLDTTAQKKI
ISTLHYALNEDGCLMLGKSETIGASTQLFTALNKKYKIYSRKKNSGTYRIPEISPRILQP
SSLDKDRSVTTMPKKIPSTPKADLSSAFDAVLLGQYVPASVIINHDLDILQFRGSTTLYL
QHGPGKASFNILKMSHLEITFELRNAIHEAIKTKQPVRKTGIEMNRDVVGNTVQIVNIEV
SPLKVEGEEPLLLVVFTGQQIDIADSPMESGEKNSIAKDRRIKKLEEELAAARAYMNSIT
QDHEAANEELQSANEEIISSNEELQSLNEELETSKEEIESTNEELTTSNHELNARIQQIE
ELYTYYETILATVHEPMLVLDKNIRIRSANESFCATFKVAEEDIIGTSMFKLSNNQWNIP
ALRELLEDIVPKNNRFHNFEVDLDFSIVGPKTLLLNAHRIVQKSKNEELIVLTMVDITDA
RKLALELQKKEKQVLDELMEAKRIAEQKTKIAEEAVKAKQQFLSNMSHEIRTPMNAIIGF
TNVVMKTKLNEAQKEYINAIKVSGESLIILINDILDLAKVEAGKMVFEHSPFRLFSSVSD
MLHLFETKMQEKNLVLIKQYDTNVPEILVGDPVRLRQIMLNLISNAVKFTNAGKITVRVD
LLKEDQDHVSVEFSVSDTGIGIPENNLKQIFDAFEQIAPETTRLNGGTGLGLAIVKQMVK
LQGGNVKVKSKVDKGSTFSFSLSFKKVKSLVAIENNHKVDFDRKDFLEKAAITNVKILVV
EDVEMNQLLMKTLLSDFGFTFDLANNGKMAIEKLQKNKYDIILMDLKMPEMSGFEATAYI
RNEMNIQTPIIALTADVTTVDFEKCQAAGMNDYISKPFDEQILYSKIVQHVKRINN
NT seq 3951 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctaatccacttcccgataaaaaaaaggcgcgttcaaaaaaaggaacctctgcc
ccagccaatccgagcgcgaatgaagggccaaaactcaagaccagaaacaaaaaagtacaa
gacaaacctgcactccctccagcagagccagaggggccacaccccttccccgtagtggcc
attggggcttcggcgggtgggctcgaagccatcacgcagctgttgcaaaatctttctccc
aataccggcatggcgttcatctacgtgcagcacctcagccctgatcacaaaagtatgctg
agtccaattttgtcaaaagcaaccgccatgccggtgcaggacattgaggacatggacaag
atgcaagccgatcaggtgtatgtgatgccctacaaccgggacattgaagtagtcgacggg
cacatcaaactgattccccgtccgcaaaacaagacctctaatctctccatcgacgtactt
ttttcttccctggccgaaacccacaaagaaaatgtgattggcatcgtactatccggcagc
gccagtgatggtacacgtgggctaaaagaaatcaagctggccggaggcatcacttttgcg
caggacgattcagcaaaattcagcagcatgccacaatctgctattgctgaaggggtggtt
gatttcattttttccccgcaaaagattgcccaggaattgaactggatgagcaaacatcct
ttggtgaaaagaactggtgtaaaacctgccccggaagatgccattgcaaacagcaacccc
aacctaaaaaacatcctgcaactcatccacaaaaaaaatggcgttgatttcagccactat
aaaatgagtaccatcaagcggcggatgctgcgccggatggtgatccataaaatggatacc
ttgaagcactacaatgaactgttggcccaaaaacccgcagaagtagacctcttgtatcag
gacttgctcatcaatgtgaccgatttttttagagatgccgaagtctttaaagtgttagcc
agcagcgttttgtccagcttgcttaaaagtaaaaaatctggtgaaacgctacgcatctgg
gtggtggcttgtgccactggcgaagaagtgtattccattgccatgatcttgtttgaattg
caaaaccagcaaaaccatcacatcccttttcaaatttttgcttccgacctcagtgcccag
gccatcagtaccgcccgggttggtgaatactccgcacacgaacttatccatgtttcgccc
caacgcatgcagcaatttttcaccaaatcgagggacaagtaccgcatcaacaaaaccctc
cgcgacgtctgtgtttttgcggagcacaacattttgagcgacccccctttttcccgcatg
gactttatcagttgccgcaatctgttgatctatctggataccactgctcagaaaaaaatc
atttccacccttcactatgccctaaatgaagacggatgcctgatgctcggtaaatcagaa
accattggtgcttctacccagctttttactgctctgaacaaaaaatacaaaatctattcc
cgcaaaaaaaattcgggtacttatcgaattcccgaaataagtccgcgtattttacaaccc
agctcactcgataaagacagatctgttactaccatgcctaaaaagataccgtccacccct
aaagctgacttgagcagtgcctttgatgccgtactgttgggtcaatatgtacccgcaagt
gtgatcatcaatcacgatctggacatcctgcaatttcggggttctactaccttatatctc
cagcatggcccaggtaaagcgagtttcaacattttaaaaatgtcgcacctcgaaatcact
ttcgaactgcgcaatgccattcatgaggccatcaagaccaaacagccggtgcgcaaaacc
ggcattgaaatgaatcgtgatgtggtaggcaacacggtacaaatcgttaacatcgaagta
tctccgctcaaagttgaaggggaagaacccttgttgttggttgtttttacgggacagcaa
attgatatagccgactccccgatggagagcggggaaaaaaattccatcgccaaagaccgc
aggatcaaaaaactggaagaagaactggctgctgcccgggcgtatatgaactccattacc
caagaccacgaggcggccaatgaagaattgcaaagcgccaatgaagaaattatttccagc
aatgaagagttgcaaagtttaaacgaagaactggaaacctccaaggaagaaattgaatct
accaacgaggaactgaccaccagcaaccacgaactaaacgcccgcattcaacaaattgaa
gaattgtatacgtattatgaaacgattctggccactgtgcatgagcccatgctggtattg
gacaaaaacatccgcatccgctcggccaatgaatcgttctgcgccacatttaaagtcgcc
gaagaagacattattggcacctccatgttcaagctgagcaacaatcaatggaatatcccc
gctctgcgcgagctactcgaagacatcgtgcccaaaaacaaccgctttcacaattttgaa
gttgacctcgatttttcaatagttggtcccaaaaccctgttgctcaatgcgcatcgcatc
gttcagaaaagcaaaaacgaagaattgattgtgctgacgatggtggacatcaccgacgca
agaaaattggctctggaactccaaaagaaagaaaaacaagtcctcgatgaattgatggaa
gccaaaagaattgcggaacaaaaaaccaaaatcgccgaagaagcggtaaaagccaaacag
caatttttgtcaaacatgagccacgaaatccgcacgcccatgaatgccatcattggcttt
accaatgtagtgatgaaaaccaagttaaatgaggcgcaaaaagaatacatcaatgccatt
aaagtttctggagaatcactgatcatcctcatcaatgacattctggatctggccaaagtc
gaggccggaaaaatggtatttgagcacagcccctttcgtttattttcttccgtttccgac
atgctgcatttgttcgaaaccaaaatgcaggagaaaaatttggtcttgatcaaacaatac
gatacgaacgttccggagatactcgttggcgatcccgtgcgtttgcgtcaaatcatgttg
aacctgatcagcaatgccgtaaagtttaccaacgcaggaaaaataacagtgcgggtggac
ctgttgaaagaagaccaggatcatgtaagtgtcgaattctccgtcagtgacacgggtatt
ggtattccggaaaacaacctgaaacagatattcgatgcttttgaacaaatcgcaccggag
acaacccgattgaacggaggaacggggctgggactggccattgtcaaacaaatggtgaaa
ttgcagggcgggaacgtaaaggtgaaaagtaaggtagataaaggttcaactttcagtttc
tctttgagtttcaaaaaagtaaaatcgcttgtcgctatcgaaaacaaccataaagttgat
ttcgaccgaaaggattttttggaaaaagcagccatcaccaacgtgaaaatattggtggtt
gaagacgttgaaatgaatcaactgctgatgaaaaccctgttgtccgactttggatttaca
tttgacctggccaacaatggaaaaatggccatcgaaaaactccaaaaaaacaagtacgac
attattttgatggacttaaaaatgccggaaatgagtggttttgaagccacggcctacatt
cgcaatgaaatgaacattcaaacccccatcatcgcacttactgcggatgttacgaccgtt
gattttgagaaatgccaggccgctggcatgaatgattatatatccaaaccttttgacgaa
cagatcctgtacagcaaaattgttcaacatgtaaaacggataaacaactga

DBGET integrated database retrieval system