KEGG   Haliscomenobacter hydrossis: Halhy_5191Help
Entry
Halhy_5191        CDS       T01491                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:hhy00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Halhy_5191
Enzymes [BR:hhy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Halhy_5191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6615437..6616348
Genome map
AA seq 303 aa AA seqDB search
MPRILVIGSSNTDMVVKTARFPQPGETIIGGDFFMFPGGKGANQAVAAARVGGVVDLIAK
VGNDVFGTQAVEGFAHEGINVAYVLTDPKLASGVALITVNGEGENEIVVAPGANAALTPA
DLDLAEAAFESTDLILMQLETPLETVLHAAKKAKALGKPFVLNPAPAQVLPAELFPLLSL
ITPNETEAALLTGLSWEGEGALSRIAEALLQKGVENVIITLGAKGAYFQNADSYFQVAAP
VVTAVDTTAAGDVFNGALAVALAEGKDWQPAIDFACQAGAIAVTRMGAQTSAPYREELML
RVE
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgccacgtatactcgtgattggaagctcaaataccgatatggttgttaaaaccgcccgt
tttccacaacctggagaaaccatcatcggcggtgatttttttatgttccccggtgggaaa
ggagccaaccaggctgtagctgctgctcgtgtcggtggggtggtggatttgatcgccaaa
gtgggcaacgacgtcttcggtactcaggctgttgaaggttttgctcatgagggcatcaat
gtagcctatgtgttgaccgaccctaagctggcctctggcgttgctctcattaccgtaaat
ggcgaaggagaaaacgaaattgtggtagctccaggggccaatgctgccctgactcctgcc
gacctggatctggccgaagcggcgtttgaaagtactgatttgatcttgatgcaattggag
acgccactggagacggtgttgcacgctgccaaaaaagccaaagctttgggcaaacctttt
gtgcttaatcccgctccagcccaggttctacccgccgagttgtttcccttgctttccctg
attacccccaacgaaaccgaggctgcgctgctcactggcttgtcttgggaaggcgaaggg
gcattgtcacgtattgccgaagctttactacaaaaaggcgttgaaaatgtcatcatcact
ttgggggcaaaaggcgcctattttcaaaatgccgattcttatttccaagttgcggcgcca
gtggtaacagccgtggatactactgcggcaggagatgtattcaacggagctttggcagtt
gctttggcagaaggaaaggattggcagcccgcgattgattttgcctgtcaggcaggcgct
attgcggttacgcggatgggggctcagacgtcggcaccgtatcgggaggagttgatgctg
cgggtggagtag

DBGET integrated database retrieval system