KEGG   Haliscomenobacter hydrossis: Halhy_5239Help
Entry
Halhy_5239        CDS       T01491                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hhy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Halhy_5239
   01230 Biosynthesis of amino acids
    Halhy_5239
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halhy_5239
   00051 Fructose and mannose metabolism
    Halhy_5239
   00562 Inositol phosphate metabolism
    Halhy_5239
Enzymes [BR:hhy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Halhy_5239
Exosome [BR:hhy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Halhy_5239
  Exosomal proteins of bladder cancer cells
   Halhy_5239
  Exosomal proteins of melanoma cells
   Halhy_5239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6673677..6674441
Genome map
AA seq 254 aa AA seqDB search
MKTRQQIVAGNWKMNKNYGEGRELAMEIVERLKPSNTQVVLCAPYIHLQLVKNIIKDVAS
LYLGAQNCHQEDKGAYTGEISVDMLKSVGVSYVILGHSERREYFGESDELLAKKTDKVLA
AGLLPIFCCGESLDIRDAGTHVAHVQAQIKAGLFHLSPEEFQKVVIAYEPIWAIGTGRTA
SPEQAQDMHAAIRALLTDQYGAEIADATTILYGGSVNGGNAAVLFSQPDVDGGLVGGASL
KAEEFITIVEATKK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacacgtcaacaaatcgttgctggcaactggaaaatgaacaaaaactacggcgaa
ggccgtgagttggccatggaaattgtggagcgcctgaagccgtccaacacccaggtggtg
ctgtgtgcgccttacatccacctgcaattggtaaaaaacatcatcaaggatgtggccagc
ttgtacctgggcgcgcaaaattgccaccaggaagacaagggcgcctacaccggtgaaatt
tcagtagatatgctcaagtcggttggggtaagctacgtgattctgggccactccgagcgc
cgcgagtattttggcgaatccgatgagctactggccaaaaagacggataaggtgttggcc
gctggcttactacccattttttgttgtggagaaagcctcgacattcgtgatgcgggtacc
catgtagctcatgttcaagcccagatcaaagcgggtttgtttcacctgagcccggaagaa
ttccaaaaagtggtcattgcgtatgagccgatttgggccattggcacgggtcgcacggct
tctcctgagcaggcgcaagacatgcacgcagccattcgcgcacttttgaccgatcaatac
ggcgcggaaattgccgatgctaccaccattctgtatggcggcagtgtcaacggcggcaac
gcggcggtacttttttcacagcccgatgttgatggtggtctggtaggtggtgcttcgctg
aaagcggaggaattcattacgattgtggaagcgacgaagaaataa

DBGET integrated database retrieval system