KEGG   Haliscomenobacter hydrossis: Halhy_5315Help
Entry
Halhy_5315        CDS       T01491                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hhy00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Halhy_5315
Enzymes [BR:hhy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Halhy_5315
Exosome [BR:hhy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Halhy_5315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6767489..6768985
Genome map
AA seq 498 aa AA seqDB search
MQQYILALDQGTTSSRAILFDHDGNVAAVRQQEFTQFYPQPGWVEHNPLEIWNTQLAVAR
EVLQANGVKPSQIAGIGITNQRETTVVWDKNTGQPVFNAIVWQDRRTAAICDELKAQGEE
AYIKAQTGLVVDAYFSGTKVKWILDNVEGAREKANRGELLFGTIDSWLVWKLTGGKVHIT
DYSNASRTLMYNIQKLEWDQHLLDVLGVPASMLPQVSPSSQIYGQTSAELFGAEIPIGGI
AGDQQAALFGQGCFQPGAAKNTYGTGCFMLMNTGKERITSNAGLLTTIAWGLNGEVHYAL
EGSVFIAGAAIQWLRDGLKIIDESPDSEFFAMKAPSTEGVYVVPAFAGLGAPYWDMYARG
AIFGLTRGTSKSHLIRATLESLAYQTKDVLGAMEKDAGTPLAVLRVDGGACANNLLMQFQ
ADILGVSVERPKIIETTALGAAYLAGLACGFWTMADLQSKWHLDRAFHPNMSAEERAKLY
KGWQKAVERTMGWEDSEK
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaatacattcttgccctcgatcaaggcaccaccagttcacgcgccatcttgttt
gaccacgatggcaatgtggccgcagtacgccaacaagagttcacccaattttatccccag
ccgggctgggtagagcacaatccgctcgaaatctggaacacccaactagcagtagcccgg
gaagtgctgcaggccaatggcgtaaagccaagtcaaattgcgggcatcggcatcaccaac
caacgcgaaaccacggtggtttgggacaaaaataccggacagcccgttttcaatgccatc
gtttggcaagaccgccgcaccgccgccatttgtgacgaactcaaagcgcagggcgaagaa
gcgtacatcaaggcccaaacgggtttggtggtggatgcctacttttcgggcaccaaggta
aaatggattctggacaatgtggaaggtgcgcgtgaaaaagccaaccggggcgagttgtta
tttggtaccatcgacagctggctggtttggaaattgacagggggcaaggtgcacatcacc
gattattcgaacgcctcacggaccttgatgtacaacattcaaaaactggaatgggaccaa
catttgctggatgttttgggcgttccggcgagcatgttgccgcaggtgagtccttccagc
cagatctatggccagaccagtgcggaattgtttggcgcagaaattcccatcggcggcatt
gcgggcgaccagcaagctgcccttttcgggcagggttgcttccagccgggtgcggccaaa
aacacctacggcacgggctgttttatgctgatgaatacggggaaggagcgcatcacgtcc
aatgccgggttgctcaccaccatcgcctggggcctgaatggtgaagtgcactatgccctg
gaaggcagtgtgttcattgccggagctgcgatccaatggttgcgcgacggcctcaaaatc
attgacgaatcaccggattcggagttttttgccatgaaggcaccgagtaccgaaggcgtt
tacgttgtgcctgcctttgctggtttgggtgcgccgtattgggacatgtacgcgcgtggg
gccatttttggactcacccgaggcacttccaaatcacacctgatccgggccacgctggaa
tccttggcttaccaaaccaaagacgtgctgggcgcgatggaaaaagacgcaggaacacca
ctcgccgttttgcgcgtcgacggcggcgcttgcgccaacaacctgctgatgcaattccag
gcggatatcctcggggtaagtgtagaacgccccaaaatcatcgaaacgactgccctcggt
gcggcctatctggcgggactggcctgcggtttttggaccatggccgatctgcaatccaag
tggcacctcgaccgcgctttccatcccaatatgtcggcggaagagcgggcgaagttgtac
aagggttggcaaaaggcggtggaaaggacgatgggctgggaggatagcgaaaagtga

DBGET integrated database retrieval system