KEGG   Haliscomenobacter hydrossis: Halhy_5342Help
Entry
Halhy_5342        CDS       T01491                                 

Definition
(GenBank) Cytochrome-c peroxidase
  KO
K00428  cytochrome c peroxidase [EC:1.11.1.5]
Organism
hhy  Haliscomenobacter hydrossis
Brite
Enzymes [BR:hhy01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Halhy_5342
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCP_MauG Cytochrom_C DHOR
Motif
Other DBs
NCBI-ProteinID: AEE53167
UniProt: F4L7E0
Position
complement(6808914..6810017)
Genome map
AA seq 367 aa AA seqDB search
MRYTLFFLIGMSFLACKPDKKDEPKPDTDLITGTYAPEDYPLNLPKWMPPLPASPGNSLT
KAGVALGRMLFYDPILSRDSTQACATCHQQAKAFTDGLATSPGIRGQNGTRSAMPLVNLA
YNTRGFFWDGRSVALEDQALLPIEDHLEMDDTWENVERKLRRHKDYPQQFRQAFGISRKT
ELTRDLVVKAISQFERTLISAYSRYDRVVWAKEDFPTDEEQRGLELFFIEYAGNQAHPGC
SHCHFNPLFTDNNYHNNGLDNVPNLNAFKDLGRGKITGFMTDNGRFRTPSLRNVALSAPY
MHDGRFKNLEEVLENYSRGGHGVANEDANIMAFPLTQQDKSDLIAFLKMLTDTSFVNNPA
FSNPFKR
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgcgttataccttattttttttaattggtatgagttttttggcttgcaagcctgacaag
aaagacgagcccaagcccgataccgatctcattacagggacttatgcaccggaggattat
cccctcaatctaccgaaatggatgcctcccctgcccgcatcgcccggcaattcactgacc
aaagccggagttgccctggggcggatgcttttttacgacccaattttatcacgagatagc
acccaggcttgcgccacttgccatcaacaagccaaagcgttcaccgatggcttggccacc
agcccgggcattcgcgggcaaaacggtacccgtagcgccatgccgctggtcaatttggcc
tacaatacccgggggttcttttgggatgggcgctcggtagcgctcgaagaccaggcgctg
ctgcccatcgaagatcatttggaaatggacgatacctgggagaacgtagaacgcaagctc
cgtcgccacaaagattacccccaacagtttcggcaagcttttggcattagccgcaaaacg
gagcttacccgcgatctggtggtcaaggccatctcccaattcgaacgcaccctgatcagt
gcttattcacgctacgaccgggtggtttgggccaaggaggatttccctacagatgaagaa
caacgcggcttggagcttttttttatcgaatatgcgggcaaccaggctcaccccggttgt
tcccattgccattttaatcccctgtttaccgacaacaactaccacaacaacggcctggac
aatgtgcccaatctaaatgccttcaaagacctggggcggggaaaaataaccggattcatg
accgacaatggtcgattccgaacgccttccttgcgcaatgtggcattgtcagcgccgtac
atgcacgatggtcgcttcaaaaatctggaagaagtactggaaaattatagccgaggagga
cacggcgtagccaacgaagatgccaatatcatggcttttccacttactcagcaagataaa
tcggatttaattgccttcctgaaaatgctcacggatacctcatttgtgaacaatccggct
ttttctaacccatttaagcggtaa

DBGET integrated database retrieval system