KEGG   Haliscomenobacter hydrossis: Halhy_5404Help
Entry
Halhy_5404        CDS       T01491                                 

Definition
glycoside hydrolase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hhy00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Halhy_5404
  Lipid metabolism
   00600 Sphingolipid metabolism
    Halhy_5404
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Halhy_5404
Enzymes [BR:hhy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Halhy_5404
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6886087..6889209)
Genome map
AA seq 1040 aa AA seqDB search
MKINTLFVIFCLLITQLQAQVSFTFKEWEDPTVVELGKEPAHTYAMSYPNAEDVFDNDFS
KSPYYQSLNGTWKFYYVNRPEERPQDFFKPEFNDWNWKEMTVPSNWELQGFGIPIYTNFV
LPFPVNPPFINHAYNPVGSYRRTFTVPDSWTGRDIYLHFGSISGCAYVWVNGKAVGMSKV
AKSPAEFRVTPFLKKGSNTLAVQVFRWHDGSYLEDQDMWRLSGLERDVFLTSKTRVHVAD
FWVKAGLDDAYRDGTLAATVDLQLSLPSDGPHSVALSIFDKQKKIVFTQTKPAANQVTFE
GKVSAPAQWSAENPNLYTAIIVLKNETGQVLEATGTKIGFRRTEIKGKNFLINGQRVWVK
GVNRHEHDPDLGKVPTRDLMIKDIVLMKQFNINTCRSSHYPNDPLWLRLCDEYGLYVIDE
ANIESHGLGAEFQFFNVPKNKHTAYDPLWKPAHHDRTRRLLERDKNHPSVVMWSLGNECG
NGEVFFETYDWLKKRDNSRPVVSEQSGEARNTDVVSPMYPSMDNMKKYADDKSKTRPYIM
CEYSHAMGNSNGNFKEYWDLIRASDNMQGGCIWDWVDQGLRSKTPDGRSFFGYGGDFGSQ
DLYNDQNFVCNGVVDADRVPHPGLYEVKKVYQNIHFENDNSSWGKIKVKNEFSFTNLRDL
DFRWELLHDGTKLKEGSFSVEANPGETKTVALNLPAYKLAAGAELLLNVYALQRLASSSI
PAGHEVAREQMVQTPYGFAPTTPAVGTLSIEKTNTAVAFKAGDISGAINLQTGGINHYSI
KGKNIKDGFFPEPYFWRAPTDNDFGNDFTNYARVWTSAHTRRMVKSAQVGVQTAEGLPLT
IVYHLPDVNADYTLQYLIQNDGAIKINATLNLPDNSKAPELPRMGMRFALPANFNQVQWY
GRGPWENYNDRHSAAHLGLYHLHTDDGWERTYVRPQESGYRTDARWIKLTNAEGVGLQVE
GAQPLSFSAMAQLTEDFDEGTVKKNRHMTDIVKRRFVTLHIDLAQRGVGGDNSWGAETHD
EYRLLAKKYSYGFTIRAIEP
NT seq 3123 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcaacacactattcgtcattttttgtcttttgatcactcaacttcaggcccag
gtgagtttcacttttaaagaatgggaagacccaacggtggtggagctcggtaaagagccc
gcgcacacctacgccatgtcgtaccccaatgccgaagatgtttttgacaatgatttttcc
aaatcaccctactaccaatccctaaacggcacctggaagttctactacgtcaaccgaccc
gaagaacgtccgcaggattttttcaagccggagttcaacgactggaattggaaagaaatg
accgtgccatccaattgggaactgcagggttttggtattccgatttataccaattttgtg
cttccattcccggtcaatcctccctttatcaatcatgcttacaatccggttggctcgtat
cggcgcacatttacggtgcccgacagctggaccgggcgtgatatttacctgcattttggc
tctatttccggctgtgcctacgtgtgggtcaacggcaaagcggtggggatgtcgaaagtg
gcaaagtcacctgccgaattcagggttaccccatttttgaaaaaaggcagcaataccctg
gccgtacaggtctttcgttggcatgacggttcttaccttgaagaccaggacatgtggcgc
ctatcgggacttgagcgagacgtatttttgacctccaaaacccgcgtacacgttgcagat
ttttgggtaaaagcgggtttggacgatgcctatcgcgatggcacgctcgctgcgactgtt
gacttacaactttccctcccttccgatggaccgcattccgtagcgttgagcatttttgac
aaacagaaaaaaattgttttcacccaaaccaaacccgctgccaatcaggtaacgtttgaa
ggcaaagtcagcgcgccagcccaatggtcagccgaaaaccccaatttgtataccgccatc
attgtgctcaaaaatgaaaccggacaagtgctagaggcaaccggcaccaagatcggtttc
cgccgtaccgagatcaaaggcaaaaatttcctcatcaatggccaacgcgtatgggtcaag
ggggtcaatcggcacgaacacgatcccgatttaggcaaagtccccacccgcgatttgatg
atcaaagacatcgtgctgatgaagcagttcaacatcaacacatgtcgctcctcccactat
cccaatgatccgctgtggctaaggctctgtgacgaatacgggctgtatgtcattgacgaa
gccaacatcgaatcacatggtttgggtgctgagtttcagtttttcaatgtccccaaaaac
aagcacaccgcctatgaccccttgtggaaaccggcccaccacgaccgcacccgccgcttg
cttgagcgcgacaaaaaccatccatccgtggtcatgtggtctttgggcaatgaatgtggc
aacggtgaggttttttttgaaacctacgactggctaaaaaaacgcgacaactctcgcccg
gtagtctccgaacaatcgggcgaagcacgcaacaccgatgtggtgagtcccatgtacccc
tcgatggacaacatgaaaaaatacgccgacgataagagcaaaacccgtccttacatcatg
tgtgaatacagccacgccatgggcaattccaatggcaacttcaaagaatattgggacctc
atccgtgcttcagacaacatgcaagggggctgcatctgggattgggttgaccagggcctt
cgcagtaaaacccccgatgggcgcagtttttttggatacggtggcgattttgggagccag
gatttgtacaacgaccaaaactttgtttgcaatggggttgtggacgccgaccgcgttccc
catcccggactttatgaagtaaaaaaggtctatcaaaacattcattttgaaaatgacaac
agctcctggggtaaaattaaagtgaaaaacgaattttcttttaccaatttgcgcgatctg
gatttccgctgggaattactccacgacggcacaaaattgaaagaaggcagctttagcgtc
gaagccaatccgggtgaaaccaaaaccgtcgcactcaatttacccgcctataaacttgcc
gcaggtgccgaattactcctcaacgtctacgctttgcaacgtttggccagttcatccatc
ccagcaggacatgaagttgcccgcgaacaaatggtgcagacgccctatggttttgcgcct
accacacccgccgtaggcacgctgagtattgaaaaaacgaataccgcagttgcgttcaaa
gctggcgacatcagcggagcaatcaatctacagaccggggggatcaaccattattccatc
aagggcaagaacatcaaggacggtttttttcccgagccttatttctggcgcgcaccaacc
gacaatgattttggcaatgattttaccaactatgcccgggtttggacttccgcgcacacg
cgccgcatggtaaaaagtgctcaggttggtgtacaaaccgcagagggtttaccccttacc
atcgtctatcaccttcccgatgtaaacgccgattacactctgcaatacctgattcaaaac
gacggagccatcaaaatcaacgcgacactcaacttgcccgacaacagcaaagctccggag
ttgccgcgaatgggcatgcggtttgcattgcccgcaaatttcaatcaggtacaatggtat
gggcggggaccatgggaaaattacaatgaccgccatagtgcagcacatctcggcctgtat
catttacacacggatgacggttgggaacgcacttatgttcggccccaggaaagtggttac
cgtaccgatgctcgttggatcaaactgaccaatgctgagggggtagggttacaagtagaa
ggtgcacaaccattgtctttcagcgcaatggcacaactcacggaagattttgacgaagga
acggtcaaaaaaaaccggcacatgaccgatattgtcaaacgtcgttttgtgaccttgcat
atcgacctggcgcaacgcggcgttggaggcgacaacagctggggcgctgaaacccacgat
gaatatcgacttttggcaaaaaaatacagctatggttttaccattcgggcgattgaacct
tag

DBGET integrated database retrieval system