KEGG   Haliscomenobacter hydrossis: Halhy_5487Help
Entry
Halhy_5487        CDS       T01491                                 

Definition
nitrous-oxide reductase
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hhy00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Halhy_5487
Enzymes [BR:hhy01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     Halhy_5487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6984557..6986545)
Genome map
AA seq 662 aa AA seqDB search
MKLNWVIPTFGFLSLLALTFSCKPKDLGTTISGDAAAKVYVAPGQKDEFYSFVSGGFNGQ
MSVYGIPSGRLLRIIPVFSQFAESGYGYSEETKPMLNTSNGFVPWDDSHHIALSTTKGEH
DGRWVFINGNNTPRIARISLKTFRTEEIIELPNSGGNHSSPFLTANTEYAVAGTRFSVPP
DAVADVPISSFKENFKGYLSFVKIDKTSGRMSIGFQLKTPAVSFDLSRCGRGVSDGWFFF
STYNTEQANTLLEVNASQKDKDFILAVNWKKAEEYLKAGKGKKEPAEYAHNVYDERTHSA
TSTMIKEVMTLDPKDCPDMLYFIPCPKSPHGCDVDPTGEYIVGSGKLAAVIPVFSFSKMI
KAIAAKKFDGEFESIPVLNYEAVLHGEVQKPGLGPLHTEFDGQGNAITSFFVSSELVKWN
IEKLEVLDRVPTYYSVGHLSIPGGPTMKPHGKYVIAYNKITKDRYLPTGPELAQSAQLYS
IDGNKMQLLLDFPTVGEPHYAEALPAALVEPNSVKFFKLEDNFHPYVAKGEKETKVVRKG
KEVHVYMTSIRSHFAPDNIEGVKVGDEVYFHVTNLEQDWDVPHGFAIRKANNAEILIMPG
ETCTLKWIPSKAGIVPMYCTDFCSALHQEMQGYVRVSPANSNVALRWGTGVNLDEAAKVS
LK
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgaattgggtcataccaacctttggattcctatcgctgctggccctgacgttc
agctgtaaacccaaagatttgggcacaaccatatccggtgacgcagccgccaaggtatac
gtagcaccgggtcaaaaggacgagttttacagctttgtatcgggtggctttaacggacaa
atgtcggtttacggcatcccttccgggcgcttgttgcgcatcatcccggttttttctcag
ttcgcggaaagcggatatgggtacagcgaagaaaccaaacccatgctcaacacctccaac
ggttttgtgccctgggatgattctcaccacatcgccctgtcgacgaccaaaggagaacac
gacgggcgttgggtttttatcaacggcaacaacacgccgagaatagcccgcatcagcctc
aaaaccttccgtaccgaagagatcatcgaattgcccaacagcgggggcaaccactcctcc
ccatttttgacggccaataccgaatatgctgtagccggcacccgtttttccgtcccacct
gatgcggttgccgacgtgccgatcagcagttttaaggaaaactttaaaggctacctcagt
tttgtcaaaatcgacaaaaccagcgggcggatgtccattggatttcagttaaaaacacca
gcggtaagctttgacttgtcgcgctgtggccgtggggtatccgacggttggtttttcttc
tctacttacaatacggaacaagccaatactttgctggaagtgaatgcttcgcaaaaagac
aaggacttcattctggccgtgaactggaaaaaggcagaagagtacctcaaagctggcaaa
ggcaaaaaagaacccgccgaatacgcccacaacgtatacgatgaaagaacccactcggct
acttctaccatgatcaaggaggtaatgaccctggaccccaaagattgtccagacatgttg
tacttcatcccttgccccaaatcaccccacggatgcgatgtagatcctacgggtgaatac
attgtaggcagtggcaagttggccgccgtgattcccgtattctcattcagtaaaatgata
aaagccattgccgctaaaaaattcgacggagagtttgaaagtattcccgtgttgaattac
gaagcggtgttgcacggtgaagtgcaaaaacccggcttggggccattgcacaccgagttt
gacggacaaggcaatgccattacttctttctttgtatcttctgaattggtcaaatggaac
attgaaaaactggaagtacttgatcgcgttcctacttattattcggtaggtcacttgagt
atccctggtggtccaaccatgaaaccacacggaaaatatgtgattgcctataacaaaatc
accaaagaccgctacctccctactggccctgaattggcccaatcggcacagttgtattcc
attgatggcaacaaaatgcagctcctgctcgacttccccaccgtgggtgaaccgcactac
gctgaagcgctcccggctgcattggttgaaccgaatagtgtgaagtttttcaaactggaa
gacaacttccacccttatgtggccaaaggtgagaaagaaaccaaggttgtgcgcaagggc
aaagaggtgcacgtgtacatgacctccatccgctcgcactttgccccggacaacatcgag
ggtgttaaggtgggcgatgaggtgtatttccacgtcaccaacctggagcaagactgggat
gtaccgcacggatttgccatccgcaaggccaacaacgccgaaattctgatcatgcctgga
gagacctgtaccctgaaatggattccatccaaagccggtatcgtgcccatgtattgtacc
gacttctgttcggcgctgcaccaggaaatgcagggatacgtccgggtttcgcccgccaac
agcaatgtggccttgcgctggggcacgggggtgaacctggatgaagcggccaaagtgagt
ttgaaataa

DBGET integrated database retrieval system