KEGG   Haliscomenobacter hydrossis: Halhy_5705Help
Entry
Halhy_5705        CDS       T01491                                 

Definition
nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hhy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Halhy_5705
Enzymes [BR:hhy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Halhy_5705
    3.5.1.-  
     Halhy_5705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7275236..7275847
Genome map
AA seq 203 aa AA seqDB search
MRTLLLIDLQNDFCPGGALAVEEGNLLIPIANDLMPRFDLVLATQDWHPATHGSFAANHP
WRKPGQVIDLHGLSQVLWPIHCVQESFGAEFVPTLNTTGIHQVFVKGTDPEIDSYSGFFD
NGHRKATGLGDYLKAQGVDELYVMGIATDYCVKFTVLDALELGFKVNLIQDACRGVNLKA
GDVAQALLDMQSKGANLITSNAV
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgagaacccttctactgattgatttacagaatgacttctgccctggcggcgcactggct
gtggaagaaggaaacctactgatccccattgccaatgacttgatgccacgttttgatctg
gtactggctacccaagactggcatccggctacacatggcagttttgccgccaatcacccc
tggcgcaaacccggccaggtgatcgatttacatggcttgtctcaggtgctttggccgatc
cattgcgtacaagaaagttttggtgccgagtttgtccccacgctgaatactacgggtatc
caccaagtttttgtcaaaggcaccgatccggaaatcgacagctacagtggattttttgac
aacggccaccgcaaagcaactggcctgggcgattacctgaaagcacaaggtgtggatgaa
ctgtacgtcatgggcattgccaccgattattgcgtgaaattcacggtattggacgcttta
gaactgggtttcaaggtcaatttgatccaagacgcctgtcggggtgttaacttaaaagca
ggcgacgttgcacaggctttactggacatgcaaagcaaaggagcaaatttaataacgtca
aatgccgtataa

DBGET integrated database retrieval system