KEGG   Haliscomenobacter hydrossis: Halhy_5975Help
Entry
Halhy_5975        CDS       T01491                                 

Definition
acireductone dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hhy00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Halhy_5975
Enzymes [BR:hhy01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     Halhy_5975
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     Halhy_5975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7633251..7633778
Genome map
AA seq 175 aa AA seqDB search
MAILTIPDKQTVINDPAEIKSFLNARGVIYEQWEAAVPFADDADQDTIIGAYAHQLKPYM
ESNGYQTADVINVTPDHPQLEMLRTKFLSEHIHTEDEVRFFVDGEGMFWFNLGGGEDIFC
VTCQAGDLISVPANTKHWFDMGPKKFVKAIRVFIDQSGWVPHYTESGVDQQYNLN
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggccattcttaccattccagacaaacaaaccgtcatcaatgatccagccgagatcaaa
agtttcctcaatgcccgtggcgtaatttacgaacaatgggaggctgcggttccttttgct
gacgatgctgatcaggacaccatcattggtgcctatgcccaccagttgaaaccttacatg
gagtccaatggctaccaaactgcggacgtgatcaatgttacgccagatcatccccaattg
gaaatgttgcgcaccaaatttttgagtgagcacatccataccgaagatgaggtgcgcttc
tttgtagatggggaaggtatgttttggttcaacctcggcggtggtgaagacatcttctgt
gtgacctgccaggctggagacctcatctcggttcctgcaaatacaaaacactggttcgac
atggggccgaaaaaatttgtcaaagccattcgggtatttattgatcagtcgggctgggta
ccgcattatacggagtctggggttgatcagcagtacaatttgaattag

DBGET integrated database retrieval system