KEGG   Haliscomenobacter hydrossis: Halhy_6546Help
Entry
Halhy_6546        CDS       T01491                                 

Definition
glycoside hydrolase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hhy00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Halhy_6546
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Halhy_6546
Enzymes [BR:hhy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Halhy_6546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8364784..8367066)
Genome map
AA seq 760 aa AA seqDB search
MKHTILGLLLCGSILLNAQSPAAFPIIPLPQKITPAAGQFVLSAETCIRFDLNNEQVALA
ANYFNQWLNSYAGFALPSSNKQEKNVIVLELNQSVKHPEGYHLQISPGQILIQAWQPVGL
FYGIQSLMQLFPIEASAAINLAGVDIQDQPAFGYRGVMLDVGRYYFSPADVKTFIDMLAR
YKINRFHWHLTEDQGWRIEIKKYPKLQEVAAWRNETIVGHLNQGAERKFDGQKNGGFYTQ
EEVKDIVEYARKRFITVIPEIEMPGHAQAAIAAYPELGCLDKPIGVATFWGVSPNVFCPN
EATFTFLENVLSEVMALFPSPYIHIGGDECPKVQWTTNATAQQIIKREKLKDEHELQSYF
IRRMEKFLNQHGRQIIGWDEILEGGLAPNATVMSWRGTEGGIEAAKQGHNVIMTPTSYCY
IDYYQSLHADEPLAIGGFLPLEKVYSYNPIPSELSPDQAKHILGAQANLWTEYIKDLSKL
QYMTYPRAQALAEVTWSGEAKKNFADFTSRLMVHMERWKKEGVNFGNHLFDVKVQASSDG
TGVKISASNPANQGTIKYVADGTMPAASSANVGTNLLLNQSGQYVFQSFMDGKPSGRSAK
LDVSFHKAAGKKITLSTEPAPQYRGSGNGSVLNGVIGSNQRYNDAEWLGFAGKDVVAVID
LGKPTALKQVKLRFFNNPGQWVYAPKQVQVSWGKQEGSFGKVLSSRVEVGKDKIVSSNLN
LKNAKARYLKLEFSNYGEIPAGAPGAGSRAWLFVDEIVVE
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacaccattctaggacttttactttgtggtagcattttgctaaacgctcaatcg
cccgctgcttttcccattattccccttccccaaaaaatcacccccgcagcggggcagttt
gtgctcagtgcagagacctgcattcgttttgacctcaacaacgaacaagtagcgctggcc
gcgaattatttcaaccaatggttgaacagctacgcgggttttgccctcccttcgagcaac
aagcaggaaaaaaacgtgatcgtgctggagttgaaccaaagcgttaaacatcccgagggc
taccacctgcaaatcagtcctggccagatcctgattcaagcctggcagcccgttggactg
ttttatgggattcaatccttgatgcaacttttcccgatcgaggccagtgcagcgatcaac
ctcgctggtgtagacatccaggatcaacctgcctttggttaccggggcgtcatgctagat
gtaggccggtattacttttcgcccgccgatgtcaagaccttcatcgatatgctggcgcgg
tacaaaatcaaccgttttcactggcacttgaccgaagatcagggttggcggattgagatc
aaaaaatatcccaaactccaggaagtcgcggcctggcgcaacgaaaccatcgtcggacac
ctcaatcaaggtgccgagcgcaaattcgacggccaaaaaaacggcggtttttatacccag
gaagaagtcaaagacatcgtggagtacgcccgcaaacgtttcatcacggtcattcctgag
attgaaatgccgggacatgcccaggctgccattgcggcgtatcctgaattgggttgcctt
gataaacccattggtgtggccaccttttggggagtatcgcctaatgtattttgccccaat
gaagccacgtttacctttttggaaaatgtgctgagcgaggtcatggcgctttttccaagc
ccctacatccacatcggtggcgacgagtgcccgaaggtgcaatggacaaccaacgcgacg
gctcaacaaatcatcaagcgggaaaaactgaaggatgaacacgaactgcaaagttacttc
atccgcagaatggaaaaattcctgaaccagcatggtcgtcagatcattggttgggacgaa
attctggaaggtggtcttgcacccaatgccaccgtcatgtcctggcgtggtaccgaaggc
ggcatcgaagctgccaagcagggccacaacgtcatcatgactccaacttcttattgttac
attgattattaccaatcattacacgccgatgagcccctggccatcggcggctttttgccc
ctggaaaaagtgtacagctacaatccaattccgagcgaactcagcccggaccaagccaaa
cacattttaggtgcacaagccaatctttggaccgaatacatcaaagatctcagcaaattg
caatacatgacctatccccgcgcccaggccctggccgaagtgacctggtctggcgaagcc
aaaaagaactttgccgattttaccagccgcttaatggtgcacatggagcgctggaaaaag
gagggggtcaattttggcaatcacctttttgatgtcaaagtgcaagccagttccgacggg
acgggggtgaaaatttctgcttcaaaccccgccaatcaaggcacgatcaagtacgttgcc
gatggtacgatgcctgctgccagcagtgcaaatgttggtaccaacctgctgctgaatcaa
agcggccaatacgtttttcaatcctttatggacggaaaacccagcggtcgttcggctaaa
ctggacgtgagtttccacaaagcagcgggcaaaaaaatcaccttgagtaccgagccagct
ccacagtaccggggatctggcaacggctccgtgctcaatggggtcatcggcagcaaccaa
cgctacaacgacgccgaatggctgggctttgcgggcaaagatgtggtagccgtcatcgac
ctgggcaaaccgactgcactgaaacaggtcaagctccgttttttcaacaaccccggccaa
tgggtctacgcgcccaaacaggtacaagtcagttggggcaagcaggaaggcagctttgga
aaagtgctcagcagcagggttgaagtgggcaaagacaaaattgtatccagcaacctcaac
ttaaaaaatgccaaagcgcgttatttgaagctcgaattcagcaactacggcgaaattccg
gcgggtgcaccgggtgcgggtagccgcgcctggttgtttgtggatgaaatagtggtggaa
tag

DBGET integrated database retrieval system