KEGG   Haemophilus influenzae R2846 (nontypeable): R2846_0025Help
Entry
R2846_0025        CDS       T01980                                 

Gene name
cysQ
Definition
3-phosphoadenosine 5-phosphosulfate (PAPS) 3-phosphatase (CysQ) (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
hie  Haemophilus influenzae R2846 (nontypeable)
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hie00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    R2846_0025 (cysQ)
Enzymes [BR:hie01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     R2846_0025 (cysQ)
Transfer RNA biogenesis [BR:hie03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    R2846_0025 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
23748..24557
Genome map
AA seq 269 aa AA seqDB search
MLTLNEHLLNQVLLIAYQAGKHLQQFYQKQVHVELKEDNTPVTEADLFVSQFLTEKLTAL
FPNIPVLSEENCHISFEERKNWKEYWLIDPLDGTQQFINRTDQFSVLITLVRKNKPVLSV
IHAPILSTTYYAMRDFGAFKKQLDQVKKLTKNTTNFDRPLRIAVGATTSQEKVRSILPKD
FTCEFVVVGSSSLKSGLVAEGAVDCYVRLGQTGEWDTAGAEVLLNETHGAIFDSHFEPLT
YNQRETLINPHFVMVGDQSFDWRSVFQFN
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgctgacgctaaacgaacacttacttaaccaagtattgctgattgcttaccaagcaggt
aagcatttgcaacagttttatcaaaaacaggttcatgttgaattgaaagaagacaacacg
cctgtgacggaagcggatctttttgtgagccaatttttaaccgaaaaattgaccgcactt
ttccctaatatccccgttctttcggaagaaaattgtcatatttcctttgaagaacgtaaa
aattggaaagaatattggttgattgatcctcttgatggcacacaacaatttattaatcgt
accgatcaattttctgtgttgataaccttagttcgtaaaaataaacccgtgttaagtgtt
attcatgcaccaattttatcgacaacttattatgcaatgcgtgatttcggtgcgtttaaa
aaacaactggatcaggtaaaaaaactcactaaaaacacgacaaattttgaccgcccttta
cgaattgcggtaggtgcaaccacttcacaagaaaaagtgcggtcgattttgccgaaggat
tttacttgtgaatttgttgtggttggttcaagtagcttaaaaagcggtttggtggctgaa
ggtgcagtagattgttatgttcgtttaggacaaacaggcgaatgggataccgctggcgca
gaagtgttgctgaatgaaactcacggtgccatttttgactctcattttgagcctttaacc
tataaccaacgcgaaacattgattaatccgcattttgttatggtgggcgatcaatcgttc
gattggcgttctgtctttcaatttaattga

DBGET integrated database retrieval system