KEGG   Haemophilus influenzae R2846 (nontypeable): R2846_0078Help
Entry
R2846_0078        CDS       T01980                                 

Gene name
rbsK
Definition
Ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
hie  Haemophilus influenzae R2846 (nontypeable)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:hie00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    R2846_0078 (rbsK)
Enzymes [BR:hie01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     R2846_0078 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(79371..80294)
Genome map
AA seq 307 aa AA seqDB search
MRKTLTVLGSINADHVISVPYFSKPGETLTGDNYQLVYGGKGGNQAVAAARLGANVEFIG
CVGSDVIGETMKNAFAQEGIDTTHINTVSQEMTGMAFIQVAQSGENSIVLASGANAHLGE
MVVRQSEAQIAQSDCLLMQLETPLSGVELAAQIAKKNGVKVVLNPAPAQILSDELLSLID
IITPNETEAEILTGIAVTDDEQSAVKAASVFHDKGIQTVMITLGAKGVFVSRKGKSRIIK
GFCVQAIDTTAAGDTFNGGFVTALLEEKAFDEAIRFGQAAAAISVTKKGAQSSIPTRQET
LEFLEHA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaccctcacggttctcggtagtattaatgctgatcatgtgatttctgttcct
tatttttctaagcctggcgaaacattaactggtgataattaccagcttgtctatggtgga
aaaggtggaaatcaggcggtagctgctgctcggttaggggcaaatgtagagtttattggc
tgtgttggctctgatgttatcggcgaaacaatgaaaaatgcgtttgcgcaagaaggaatt
gatacaacccatattaataccgtttcacaggaaatgacgggaatggcatttattcaagtt
gcccaatcgggcgagaacagtattgtgctggctagcggtgcaaatgcacatttgggtgag
atggttgttcgtcaaagtgaggcacaaattgcacaatcggattgcttgttaatgcaatta
gaaaccccactttctggtgtggagctggctgctcaaatcgctaagaaaaatggtgttaag
gttgtgctaaatcctgctccagcgcagattttatcggacgaattattgagtttgattgat
attattacaccaaatgaaactgaagctgaaatcctgacggggatagcggtaaccgacgac
gagcaaagtgcggtgaaagctgcgagtgtttttcacgataaaggcattcaaaccgtaatg
attacccttggcgcgaaaggtgtgtttgtcagtcgaaaaggtaaaagccgcatcattaag
ggcttttgtgtgcaagcaatagatactaccgcagctggtgatacatttaatggcggtttt
gttacggctttattggaagaaaaagcctttgatgaagccattcgttttgggcaagctgcc
gctgcgattagtgtgacgaaaaaaggggctcaatcctctattccaacgcgtcaagaaact
ttggaatttcttgaacacgcttaa

DBGET integrated database retrieval system