KEGG   Haemophilus influenzae R2846 (nontypeable): R2846_0137Help
Entry
R2846_0137        CDS       T01980                                 

Gene name
recR
Definition
Recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
hie  Haemophilus influenzae R2846 (nontypeable)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:hie03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(136752..137354)
Genome map
AA seq 200 aa AA seqDB search
MQSSPLLEHLIENLRCLPGVGPKSAQRMAYHLLQRNRSGGMNLARALTEAMSKIGHCSQC
RDFTEEDTCNICNNPRRQNSGLLCVVEMPADIQAIEQTGQFSGRYFVLMGHLSPLDGIGP
REIGLDLLQKRLVEESFHEVILATNPTVEGDATANYIAEMCRQHNIKVSRIAHGIPVGGE
LETVDGTTLTHSFLGRRQID
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagcagcccacttttagaacaccttattgaaaacttacgttgtcttcctggcgta
gggcctaaatctgcgcaacgtatggcttatcatcttttacagcgtaatcgtagcggtgga
atgaatttagctcgagcactcacagaagctatgtctaaaattggccattgttcacaatgt
cgagactttacggaagaagatacttgcaacatttgcaataatccacgccgtcaaaattca
ggtttgctttgtgtcgttgaaatgccagcagatattcaagcgattgagcaaacagggcaa
ttttcaggacgttattttgttttaatgggacatttgtctccacttgatggtattggacct
cgtgaaattggcttagatttactgcaaaaacgcttagtagaagaatctttccacgaagtg
attcttgcaacaaacccaactgtggaaggcgatgcaacagcaaattacattgctgaaatg
tgccgccaacataatatcaaagtgagtcgtatcgctcacggtatccctgtcggaggggaa
cttgaaactgtggacggcacaacgcttactcactcttttctaggtcgtcgtcaaatcgac
taa

DBGET integrated database retrieval system