KEGG   Haemophilus influenzae R2846 (nontypeable): R2846_0267Help
Entry
R2846_0267        CDS       T01980                                 

Gene name
ruvA
Definition
Holliday junction resolvasome, DNA-binding subunit
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
hie  Haemophilus influenzae R2846 (nontypeable)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hie00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    R2846_0267 (ruvA)
Enzymes [BR:hie01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     R2846_0267 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
260764..261378
Genome map
AA seq 204 aa AA seqDB search
MIGRLQGILLEKQPPEILLNVQGVGYELLLPMTSFYDLPEIGQETTLFTHLVVREDAHLL
FGFAQKTDRTLFRELIKTNGVGPKLALAILSAMSVEQFAYAIEREELSKLTKIPGVGKKT
AERLLVELKGKFKGVKQSDFFVESTHIPLSPSIESHSESSSDEAISALIALGYKPVEAEK
MVKRVAKPALTSEQVIREALKAAL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtcgcttacaaggcattcttttagaaaaacaacctccagaaattttacttaat
gtgcaaggcgtaggctatgaattgcttttgcctatgacgagtttctatgatttaccagaa
attggacaagaaacaactttattcacccatcttgttgttcgtgaagatgctcacttactc
tttggatttgcccagaaaacagaccgcactttatttcgtgaattaattaaaacaaatggg
gtggggcctaaattagccttagcgattttatccgccatgtcggtcgaacaatttgcctat
gcaatagagagagaagaactttctaaactcactaaaattccaggtgttggcaaaaaaaca
gctgaacgtttgttagttgaactcaaaggtaaatttaaaggcgtaaaacaaagcgatttc
tttgtagaaagtacgcatattccattatccccatctattgaatcccactcggaaagttca
tctgatgaagcaatttcagccttgattgctttaggttataaacctgtagaagcagaaaaa
atggtaaaacgcgttgctaaacctgcattaaccagtgaacaagttattcgtgaagcatta
aaagccgcattgtag

DBGET integrated database retrieval system