KEGG   Haemophilus influenzae R2846 (nontypeable): R2846_0556Help
Entry
R2846_0556        CDS       T01980                                 

Gene name
thrC
Definition
Threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hie  Haemophilus influenzae R2846 (nontypeable)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hie00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    R2846_0556 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    R2846_0556 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    R2846_0556 (thrC)
Enzymes [BR:hie01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     R2846_0556 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
563404..564681
Genome map
AA seq 425 aa AA seqDB search
MNLYNIKHPEEQVTFSQAVRQGLGRDQGLFFPEVIPKLNNINELLELPLVERSQKILGAL
IGEELPKATLDEMVRNAFTFTAPLEKVEDNIYALELFHGPTLAFKDFGGRFMAQALAAVR
GDGKTTILTATSGDTGAAVAHAFYGLKNINVVILYPKGKISPLQEKLFCTLGGNIRTVAI
NADFDACQALVKQAFDDVELRQAIGLNSANSINISRLLAQVCYYFEAVAQLPKEKRDNVV
VSVPSGNFGNLTAGLIAKTLGLPIKRFVASTNANDTVPRYLKSGNWDPKTTVATLSNAMD
VSRPNNWPRVEELFKRNGWDLTDLGSGMLSDSETEDTLKAMQSKGYLCEPHGAIAYQVLK
DQLKADEVGIFLCTAHPAKFKESVERILGIQLPLPETLDKHNQLPLLSDEMDNDFAQLRA
YLLKS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaatttatacaatatcaaacacccagaagaacaagtcactttttctcaggctgttcgt
caaggtcttgggcgggatcaaggtttattctttccagaagttattcctaaacttaataac
attaatgaattacttgaattgcctcttgttgagcgtagccaaaaaattctaggtgcatta
attggtgaagaattaccgaaagcaacgttagacgagatggtgagaaatgcattcactttc
accgcaccgttagaaaaagttgaagataatatttatgcacttgaattatttcatggtccc
acattggcatttaaagactttggtggtcgttttatggcacaggcacttgctgcggtacgt
ggtgatggaaaaaccaccattttaacggctacgtctggcgatactggagctgctgtagca
catgcgttttatggattaaaaaatattaatgtagttatcctttatccaaaaggtaaaatc
agcccattacaagaaaagctattctgtactttaggtgggaatattcgtactgttgcgatt
aacgctgatttcgatgcgtgccaggctttagttaagcaagcctttgatgatgttgaattg
cgccaagctatcgggcttaactctgcaaattctattaatatcagccgtttattagctcaa
gtttgttattactttgaggctgtcgcacaattgccaaaagaaaaacgtgataatgtcgtg
gtttctgtgccaagcggtaattttggtaacttaacggcgggattaattgcaaaaacctta
ggcttgccgataaaacgctttgtcgcctcaacaaacgcaaatgatactgtgccacgttat
ttgaaatcgggtaattgggatcctaaaacgacagttgcaaccctttctaatgcaatggat
gtaagtcgcccaaataattggccgagagtggaggaattgtttaaacgaaatggttgggat
ttaactgatttaggttcggggatgctaagtgatagcgaaacagaagatactttaaaagcg
atgcagtcgaaaggttatttatgtgagcctcacggtgcgatagcttatcaggtgttgaaa
gatcaacttaaagcagatgaagtaggcattttcttgtgcactgcacatccagcgaaattt
aaagaatccgtagaacgtattcttggtattcagcttccattacctgaaacactggataaa
cataatcagctaccattgctttctgatgaaatggataatgattttgcacaactacgggct
tacttattgaagtcataa

DBGET integrated database retrieval system