KEGG   Haemophilus influenzae R2846 (nontypeable): R2846_0647Help
Entry
R2846_0647        CDS       T01980                                 

Gene name
gmk
Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
hie  Haemophilus influenzae R2846 (nontypeable)
Pathway
hie00230  Purine metabolism
hie01100  Metabolic pathways
Module
hie_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:hie00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    R2846_0647 (gmk)
Enzymes [BR:hie01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     R2846_0647 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin RsgA_GTPase AAA_16 MMR_HSR1 ABC_tran AAA_25 AAA_22 Zeta_toxin AAA_29 AAA_23
Motif
Other DBs
NCBI-ProteinID: ADO96067
Position
656424..657050
Genome map
AA seq 208 aa AA seqDB search
MSQGNLYILSAPSGAGKSSLISALLASDSSTQKMVSVSHTTRAPRPGEVEGVHYYFVSKE
EFESLIEQDLFLEYAKVFGGNYYGTSLPAIEENLAKGIDVFLDIDWQGAQQIRKKVPSVK
SIFILPPSLPELERRLIGRGQDSEEVIAERMSKAISEISHYDEYDYVIVNDDFEKTLKDL
QSILQSERLTKDYQQKQNAMLIQQLLAK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaaggtaatctttatattttatctgcaccaagtggcgcaggaaaatcttcatta
atttctgcgttattggcatcagatagttcaactcaaaaaatggtttctgtgtcacatacg
acccgtgccccacgcccaggtgaagttgaaggcgtacactattattttgtatcaaaagaa
gagtttgaatcactcattgaacaagatttatttctagaatatgccaaagtttttggtggc
aattattatggaacctctttacctgcgattgaagaaaatttagcaaaaggcattgatgta
tttttagatattgattggcagggtgcccaacaaatccgtaaaaaagtgccttcagtaaaa
agcatttttattttaccgccttcattgcctgaattagagcgtcgtttaattggtcgtggg
caagatagtgaagaggttattgccgaacgaatgtcaaaagcgataagtgaaatttcgcat
tatgacgaatatgattatgtcattgtgaatgatgattttgagaaaacattaaaagattta
caaagtattttgcaatcggaacgcttaactaaagattatcaacaaaaacaaaatgcaatg
ttaattcaacagctactagcaaaatag

DBGET integrated database retrieval system