KEGG   Haemophilus influenzae R2846 (nontypeable): R2846_0759Help
Entry
R2846_0759        CDS       T01980                                 

Gene name
aceF
Definition
(GenBank) Dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
hie  Haemophilus influenzae R2846 (nontypeable)
Pathway
hie00010  Glycolysis / Gluconeogenesis
hie00020  Citrate cycle (TCA cycle)
hie00620  Pyruvate metabolism
hie01100  Metabolic pathways
hie01110  Biosynthesis of secondary metabolites
hie01120  Microbial metabolism in diverse environments
hie01130  Biosynthesis of antibiotics
hie01200  Carbon metabolism
Module
hie_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hie00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    R2846_0759 (aceF)
   00020 Citrate cycle (TCA cycle)
    R2846_0759 (aceF)
   00620 Pyruvate metabolism
    R2846_0759 (aceF)
Enzymes [BR:hie01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     R2846_0759 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N HlyD_D23 GCV_H HlyD_3 Ribosomal_60s
Motif
Other DBs
NCBI-ProteinID: ADO96171
Position
complement(787635..789266)
Genome map
AA seq 543 aa AA seqDB search
MSKQIQIPDIGSDEVTVTEVMVNVGDTISVDQSIINVEGDKASMEVPAPEAGVVKEILVK
VGDKVSTGTPMLVLEAAGTAPVADAPTAPAADEPTAPVVATAPTASAIVEVNVPDIGGDE
VNVTEIMVAVGDTITEEQSLITVEGDKASMEVPAPFGGVVKEILVKSGDKVSTGSLIMRF
EVPGAAPAASASDSASAPQAAAPAAATTAQAPQSNNNVSGLSQEQVEASTGYAHATPVIR
RLAREFGVNLDKVKGTGRKGRIVKEDIEAYVKTAVKAYESGATAQATGNGVANGAGLGLL
PWPKVDFSKFGEIEEVELSRINKISGANLHRNWVIIPHVTHFDKADITDLEAFRKEQNAL
AEKQKLGVKITPVVFIMKAVAKALEAYPRFNSSITEDAQRLILKKYINIGVAVDTPNGLV
VPVFKNVNKKGIIELSRELMEVSKKAREGKLTASDMQGGCFTISSLGGIGTTHFAPIVNA
PEVAILGVSKSSMEPVWNGKEFAPRLILPMSLSFDHRVIDGADGARFISYLGSVLADLRR
LVM
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaacaaattcaaattcctgatattggtagtgatgaagttaccgtaacagaagtg
atggtaaacgtaggcgataccatttctgttgatcaatctatcattaacgttgaaggcgat
aaagcttcaatggaagtgcctgcaccagaagcgggtgttgtaaaagaaattttagtgaaa
gtgggcgataaagtttcaactggtactccaatgcttgtattagaagcggcaggtactgct
ccagtagctgatgcgcctactgctccagcagctgatgagcctactgcaccagtggttgct
accgcaccaacggcttcagctattgtagaagtaaatgtgccagatattggtggcgatgaa
gtcaatgtaaccgaaattatggttgcagttggcgatacaatcactgaagaacaatcttta
attaccgttgaaggcgataaagcctcaatggaagttcctgcaccattcggcggtgtggta
aaagaaattttagtgaaatcaggcgataaagtttcaactggttcattaattatgcgtttt
gaagtaccaggtgcagctccagcagcatcagcatcagattcagcatcagcaccacaggca
gcagctcctgctgctgctactactgcacaagcacctcaatcaaataacaacgtatctgga
ttaagccaagaacaagtagaagcaagtacaggatatgcacacgcaacaccagttattcgt
cgtttagctcgtgaatttggtgtaaatctagataaagtaaaaggtactggtcgtaaaggt
cgtatcgttaaagaagatattgaagcttatgtgaagaccgcagttaaagcttatgaaagc
ggtgcaacagcacaagctactggcaatggtgtagcaaatggtgctggattaggcttattg
ccatggccaaaagttgatttcagtaaatttggcgaaattgaagaagttgaattaagtcgt
atcaacaaaatttcaggtgctaacttacatcgtaactgggtaataattccacacgttact
cacttcgataaagcagatatcacggatttagaagcattccgtaaagaacaaaatgcgtta
gcagaaaaacaaaaacttggtgtaaaaatcacgccagttgtgttcattatgaaagcggtg
gcaaaagcattagaagcgtatccacgtttcaacagctcaattaccgaagatgctcaacgc
ttaatcctgaaaaaatatattaacatcggtgtcgcagtagatacgccgaatggcttagta
gtgcctgtattcaaaaatgtgaacaagaaaggcattatcgaactttcacgtgaattaatg
gaagtgtcgaaaaaagcccgtgaaggcaaattgactgcatctgatatgcaaggtggctgt
ttcaccatttcaagtcttggtggtattggtacaacgcactttgcgccaatcgtaaatgcg
ccagaagtagctatccttggtgtgtctaaatcatcaatggagccagtatggaacggtaaa
gaatttgcaccacgcttaattcttccaatgtcattatcattcgaccaccgtgtcattgat
ggtgcagatggtgctcgtttcattagctatcttggctcggttttagcagatttacgtcgc
ttagtaatgtaa

DBGET integrated database retrieval system