KEGG   Haemophilus influenzae R2846 (nontypeable): R2846_0835Help
Entry
R2846_0835        CDS       T01980                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
hie  Haemophilus influenzae R2846 (nontypeable)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hie00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    R2846_0835 (malQ)
Enzymes [BR:hie01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     R2846_0835 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
881819..883918
Genome map
AA seq 699 aa AA seqDB search
MVSMQISDSLKQKAEKCGIALSHYDIDGHLIFADEKTVLTFVELLQPPPKAKGQFDDVLA
AFENEPINYRLNRLDLPPSAEYRYQLTDESNAILLEKILSNLSALSLPPLPFGYYQLSIF
SDTEQYRVRLLISPKTAFQPSVLKNKKVWGVNVQLYSLRSEQNWGIGDFGDLATLIEQSA
KQGADYVGINPLHLPYPAVPNWASPYSSSSRRWLNFLYLDIPDLPEFKRCRSVQNWFKRE
DIQAKIAALRESDCVDYSSILALKLTALESLFDFFQRSQSVEIVTRRKIFAEYLKNKGEP
LLLQGLFNVLDLQEHADHQAEENTIGWLGWRREWQHLSAAKRKALLKIHHEQIQFFAWLQ
WLTEEQLSALQNLCKQSGMKLGIYGDLAVNSSRGSADVWSDPDLYCVNASIGAPPDPLGP
VGQNWNLPPYNPTVLKARGFAPFIDMLRANMQYFGVLRIDHVMGLFRLWWIPKGKTAADG
AYVHYPFDELMAILAIESVRNECLIIGEDLGTVPDEVRWKLNEFQMFSYFVLYFAQRNGE
FPRISDYPRNAYATIGTHDVPSLQSFWHCRDLELFNQLGILNGEVIKQKYDQRVMDKQAL
LNSLHRDNYLPPHYEGDALSMAMHDYLNRMIHYYLAESNSRLIGVQLENLLSQEISFNLP
ATSNEYPNWCKKLAQPLAFIFSNEALKTFFVQINQGRNV
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
gtggtgtctatgcaaatctcggattctctcaaacaaaaagcagaaaaatgcggtatcgcg
ctttctcactatgatattgatggacatcttattttcgcggatgaaaagacggttttaact
tttgttgagcttttgcagcctccgccaaaagcgaaaggacagtttgatgatgttctggct
gcatttgaaaatgaaccgattaattatcgactcaatcgtttagatttgccaccatctgcg
gaatatcgttatcagctgactgatgaatctaatgctattctgttagaaaaaatactttca
aatttatccgcactttctttacctccacttccttttggctattatcaattatctattttt
tccgatactgaacagtaccgcgttcgtttacttatttctcctaaaacagcttttcaacca
tccgtattaaaaaataaaaaagtgtggggcgtgaatgtgcaactttacagtttacgctca
gaacaaaactgggggattggcgattttggcgatttggccactttgatcgaacaaagtgca
aaacaaggggcggattatgtgggaattaatccattacatttgccatatcctgctgtgcca
aactgggctagcccttatagttcatcttcccgtcgttggttgaatttcttatatttggac
attcctgatttacccgaatttaagcgttgccgttcagtacaaaattggtttaagcgtgag
gatattcaagcaaaaattgctgctttacgtgaaagtgattgcgtcgattattcttcaata
ttggctttaaaattaaccgcacttgagtccctgtttgatttctttcaacgtagtcaatcc
gttgaaattgtgacgcgtcgaaaaatctttgctgagtatttaaaaaacaaaggtgaacct
ttgttgttacagggtttatttaatgtcttggatttacaagaacacgctgaccatcaagca
gaagaaaataccattggttggcttggctggcgtagggaatggcaacatttaagtgcggca
aaaagaaaagctctattaaaaatacaccatgagcaaatccaattttttgcttggttgcaa
tggcttacagaagaacaactttccgcattacaaaatctttgtaaacagtctggcatgaag
ttgggtatttatggcgatttagccgtaaatagttctcgtggcagtgctgatgtatggagc
gatcctgatttatattgtgtaaatgcctctattggtgcgccacctgatccgttaggccca
gtcgggcaaaattggaatttgccgccttataatccaacagtattaaaagcacgtggcttt
gcaccatttatcgatatgctacgtgccaatatgcaatatttcggtgtgctacgcatcgat
catgttatgggcttatttcgtttgtggtggattccaaaaggaaaaaccgcggctgacggt
gcttatgtgcattatccttttgatgaattaatggcgattcttgccattgaaagtgtacgc
aatgaatgtttgattattggtgaagatctcggcactgtgcctgatgaagtgaggtggaaa
ttaaacgagtttcaaatgttctcttattttgtattgtatttcgcccaacgaaatggcgaa
tttcctcgtatatctgattatcctcgaaatgcttatgccactattggtacacatgatgtt
ccctcattacaaagtttttggcattgccgtgatttagaattatttaatcaacttggtatt
ctgaatggggaagtgatcaagcaaaaatatgatcaacgtgttatggataaacaagcttta
ttaaatagtttacatcgtgataattatttaccgccgcattatgaaggcgatgccctttct
atggcgatgcacgattatttaaatcgaatgatccattattatttagcggaaagtaacagc
cgattgattggtgtgcaattagaaaatttacttagccaagaaatcagttttaatttaccg
gccacctcaaatgaatacccaaattggtgcaagaaacttgctcaaccgttagcgtttatt
tttagcaatgaagctttaaaaacgttctttgtgcaaattaaccaagggcgaaatgtataa

DBGET integrated database retrieval system