KEGG   Haemophilus influenzae R2846 (nontypeable): R2846_0878Help
Entry
R2846_0878        CDS       T01980                                 

Gene name
holC
Definition
DNA polymerase III subunit chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
hie  Haemophilus influenzae R2846 (nontypeable)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:hie00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:hie00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:hie03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:hie03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:hie03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(940145..940579)
Genome map
AA seq 144 aa AA seqDB search
MAKTAQFYILTENCTLTVEEIACNLAASIWRSGKKVLISCKSESQALEIDELLWQRDPNE
FVPHNLSGEATQYPTPIEISWLGKRNLQRRDVLINLQQEIPDFSHSFTQIIDFVPKDDAL
KTQARERYKQLRLQGWNLSTENVG
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaactgcacaattttatattcttacggaaaattgtactttaactgtcgaagaa
atagcctgtaatcttgctgcttcaatatggcgttcagggaaaaaagtactaattagttgc
aaaagtgagagccaagcattagaaattgatgagcttttgtggcaacgagatcccaatgaa
tttgttccgcataatttatcgggtgaggcaacacaatatcccacaccgattgagatttca
tggcttggaaaacgaaatttacaacgtcgtgatgtgttaattaatttgcaacaagaaatc
ccagattttagccatagttttacccaaattattgattttgtgccgaaagatgatgcgtta
aaaacacaagctcgagaacgttataaacaattacgtctgcaaggttggaatctttctact
gaaaacgtgggttaa

DBGET integrated database retrieval system