KEGG   Haemophilus influenzae R2846 (nontypeable): R2846_0908Help
Entry
R2846_0908        CDS       T01980                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hie  Haemophilus influenzae R2846 (nontypeable)
Pathway
hie00260  Glycine, serine and threonine metabolism
hie00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hie01100  Metabolic pathways
hie01110  Biosynthesis of secondary metabolites
hie01130  Biosynthesis of antibiotics
hie01230  Biosynthesis of amino acids
Module
hie_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hie00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    R2846_0908 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    R2846_0908 (trpB)
Enzymes [BR:hie01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     R2846_0908 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADO96312
Position
962160..963353
Genome map
AA seq 397 aa AA seqDB search
MSDTLLNPYFGEFGGMYVPEILVPVLKQLEQAFVEAQNDSTFQAEFADLLKNYAGRPTAL
TLCRNLTKGTKTKLYLKREDLLHGGAHKTNQVLGQILLAKRMGKTRIIAETGAGQHGVAT
ALACAMLDMPCRVYMGAKDVERQSPNVFRMRLMGAEVIPVQKGSCSLKDACCEAMRDWSA
NYETTHYLLGTAAGPHPFPTIVREFQKMIGIETKRQILEREARLPDAVIAAVGGGSNAIG
MFADFIEETAVKLIGVEPAGKGIETGEHGAPLKHGTTGIYFGMKSPIMQDKDGQIEESYS
ISAGLDFPSVGPQHAYLNAIGRADYVSITDEEALNAFQELAKHEGIIPALESSHALAYAL
KLIKQNPEKEQLLVVNLSGRGDKDIFTVDKILNGESN
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacacacttctcaacccttatttcggcgaatttggcggaatgtatgtacccgaa
attttagtgcctgttttaaaacaattagaacaagcctttgtagaagcacaaaatgattct
acatttcaagcagaatttgctgatttactcaaaaattatgcaggcagaccgacagcactt
accctttgtcgtaacttaaccaaaggcacaaaaacaaaactttatcttaaacgtgaagat
ttattacacggtggtgcacacaaaaccaaccaagtgttagggcaaattttactggctaaa
cgtatgggcaaaacacgtattattgccgaaactggtgcgggtcagcacggtgttgcgaca
gctctagcttgtgctatgttagatatgccgtgccgtgtttatatgggggctaaagatgtt
gaacgtcaatcgccgaatgtatttcgtatgcgtttaatgggggctgaagtaattcctgta
caaaaaggctcttgttctttaaaagacgcctgttgtgaagcgatgcgcgattggtcagca
aactatgaaaccacccattatttacttggaacggcggcaggcccccatccattcccgacg
attgtgagagaatttcaaaaaatgattgggattgagacgaaacgtcaaattctcgaacgg
gaagctcgtttacctgatgcagtgattgctgctgttggtggtggctcgaatgcaattggt
atgtttgcggatttcattgaagaaaccgctgtgaaactcatcggcgtagaacctgcgggt
aaaggtattgaaacgggcgaacacggtgcaccactcaagcacggcacaacaggcatctac
ttcggaatgaaatcgccaattatgcaagataaagatggacaaattgaagaatcttattct
atttctgcaggattagacttcccttccgtcgggccgcaacacgcttatttaaatgcgatt
ggtcgtgctgattatgtatcgattaccgatgaagaagccctcaacgcattccaagaattg
gcaaaacacgaaggtattattcctgcattagaaagctcacacgccttggcttatgccttg
aaattgattaaacaaaatcctgaaaaagaacaacttttagtggttaatctttcaggacga
ggcgataaagatatttttaccgttgataaaattttaaatggagaatcaaactaa

DBGET integrated database retrieval system