KEGG   Haemophilus influenzae R2846 (nontypeable): R2846_0909Help
Entry
R2846_0909        CDS       T01980                                 

Gene name
trpA
Definition
Tryptophan synthase, alpha subunit (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hie  Haemophilus influenzae R2846 (nontypeable)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hie00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    R2846_0909 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    R2846_0909 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    R2846_0909 (trpA)
Enzymes [BR:hie01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     R2846_0909 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
963353..964159
Genome map
AA seq 268 aa AA seqDB search
MSRFETQFATLKAKNEGAFVPFVTLCDPTFDRSFEIICTLVDNGADALELGFPFSDPLLD
GPVIQAANNRALTAGHSSEDSFKLLEKVRSKYPEIPISLLLCANLIFAKGLDDFYQRCAE
VGVDAVLVADIPLLAKEDYVQAAKKHGIQPVFICPPNADEKTIQGVAENSEGYTYLVSRA
GVTSAENQAHAANLDTLVEQLKAHNAPPILQGFGIAQPAQVKEALALGAAGAISGSATVK
IIERNLDNHEQCLAELAEFVQTMKAATK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagccgttttgaaacgcaatttgcgacacttaaagcaaaaaatgaaggtgctttcgtg
ccgttcgttaccctttgcgaccctactttcgaccgctcttttgagatcatttgcacactt
gtcgataacggtgcggatgctttagaactcggttttcctttttccgatccactccttgat
ggccctgttatccaagcggcaaataatcgtgctttgactgcaggtcatagcagtgaagat
agctttaaactattggaaaaagtgcggtcaaaatatccagagattccgattagcttatta
ctttgtgctaatttaatttttgccaaaggcctagacgatttttatcaacgttgtgcagaa
gtcggtgttgatgctgtgcttgtagcagatattccgttactggcaaaagaagattatgtg
caagcagctaaaaaacacggcattcaaccggtatttatttgcccaccaaatgcggacgag
aaaacgatccaaggtgtagcggaaaatagcgaaggatatacttatttagtctcacgtgca
ggcgtaaccagtgcagaaaatcaagctcatgcagcaaatttggacacccttgtagaacag
cttaaagcccataatgccccaccaattttacaaggcttcggcattgcacagcctgcacaa
gtgaaagaagccttagctttgggggcggctggtgcaatttcaggttcagcaacagtaaaa
attattgagcgaaatttagataatcacgagcaatgtttagctgaattagctgaatttgtt
caaacgatgaaagctgcaacaaaataa

DBGET integrated database retrieval system