KEGG   Haemophilus influenzae R2846 (nontypeable): R2846_0941Help
Entry
R2846_0941        CDS       T01980                                 

Gene name
folP
Definition
7,8-dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hie  Haemophilus influenzae R2846 (nontypeable)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hie00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(989265..990095)
Genome map
AA seq 276 aa AA seqDB search
MKLYANNKCLDLSVPQIMGILNFTPDSFSDSGQFFSLDKALFQVEKMLEEGATIIDIGGE
STRPNDADEVSEQEELHRVVPVVEAVRSRFDCWISVDSSKAVVMREAASVGMDLINDIRA
LQEPNALETAVKLALPVCIMHMQGQPRTMQANPHYENVVQDVFAFLQKRTNECLSAGVKK
ENLIWDMGFCFGKSVQHNYQLLQNLNEFCHSGYPVLAGLSRKSMIGAVLNKAVDQRVIGS
AAGALIAAQKGAKILRVHDVAATSDMLKVWQATENA
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaaactttacgcgaataataaatgtcttgatttaagcgtgcctcaaattatggggatt
cttaattttacgcctgattctttttctgatagcggacagttttttagtctagataaagca
ctttttcaagttgaaaaaatgctagaagaaggggcgacaattattgatattggtggtgaa
tctacgcgtcctaatgatgcggatgaagtctctgaacaagaagaattgcatcgtgttgtg
ccagtagtggaggcggtgcgaagccgttttgattgctggatttctgtcgattcttcaaaa
gcagttgtgatgcgtgaagcagcaagtgttggaatggatttgattaatgatattcgtgct
ttgcaagagccaaatgcgttagaaaccgcagtaaaactagctttacctgtttgtatcatg
catatgcaagggcaacctagaacgatgcaggcaaatcctcattatgagaatgtcgtacaa
gatgtattcgcttttttacagaaacgtactaatgaatgtctttctgctggtgttaaaaaa
gaaaacttaatttgggacatgggattttgttttggtaagtctgtacagcataattatcaa
ttattacaaaatctgaatgaattttgtcatagtggatatcctgtgttagcgggattatct
cgcaaatcaatgattggcgctgtgcttaataaagccgtcgatcagcgagtgataggtagt
gcggcaggtgcgcttattgctgcgcaaaaaggtgcaaaaattttacgcgtacatgatgtt
gcagcaacatcagatatgctcaaagtttggcaggcaacagaaaatgcctga

DBGET integrated database retrieval system