KEGG   Haemophilus influenzae R2846 (nontypeable): R2846_0958Help
Entry
R2846_0958        CDS       T01980                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
hie  Haemophilus influenzae R2846 (nontypeable)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hie00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    R2846_0958
Enzymes [BR:hie01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     R2846_0958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1007943..1008755)
Genome map
AA seq 270 aa AA seqDB search
MKTTLLKTLTPELNLVQHNDIPVLHLKHAVGTAKISLQGAQLISWKPQNAKQDVLWLSEV
EPFKNGNAIRGGVPICYPWFGGVKQPAHGTARIRLWQLSHYYISVHKVRLEFELFSDLNI
IEAKVSMVFTDKCHLTFTHYGEEPAQAALHTYFNIGDINQVEVQGLPETCFNSLNQQQEN
VPSPRHISENVDCIYSAEKMQNQILDKSFNRTIALHHHNASQFVLWNPWHKKTSGMSETG
YQTMLCLETARIHHLLEFGESLSVEISLKG
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaacattactaaaaacactgacaccagagcttaatcttgttcaacataacgac
attccagttcttcacttaaaacatgctgttggaacagcaaaaatttccctgcaaggggca
cagcttatcagttggaaaccgcaaaatgcgaagcaagatgtattatggctaagtgaagta
gagccattcaaaaatggcaatgctattcgtggtggtgtaccgatttgttatccttggttt
ggtggcgtaaaacaacctgcgcacggtacagctcgtattcgtttatggcagttgagtcat
tactatatttcagtgcataaagtgcggttagaatttgagttgttttctgatttaaatatt
atcgaagctaaagtctcaatggtatttacagataaatgtcatttaacttttacccattat
ggcgaagaaccagcccaagcagcattacatacctattttaatattggggatattaatcaa
gtggaagtacaaggtttacctgaaacttgttttaatagcttaaaccaacaacaagaaaat
gttccgtcaccgcgtcacatttctgaaaatgttgattgcatttattccgcagaaaaaatg
cagaatcaaatcctagataaaagtttcaatcgtacaattgcactgcatcatcataatgca
agtcaatttgtcctttggaatccttggcacaaaaagacgagtggaatgagtgaaactggc
tatcaaacgatgttgtgcttagaaactgcacgcattcatcacttacttgaatttggcgaa
agtttaagcgtagaaatttcgcttaaaggctaa

DBGET integrated database retrieval system