KEGG   Haemophilus influenzae R2846 (nontypeable): R2846_1131Help
Entry
R2846_1131        CDS       T01980                                 

Gene name
dsbC
Definition
Protein disulfide isomerase II (EC:5.3.4.1)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hie  Haemophilus influenzae R2846 (nontypeable)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1189269..1189958)
Genome map
AA seq 229 aa AA seqDB search
MKKIFTALLCVAAANAMADDAAIKRKLQSFNVSNIAIKSSPISGIRTAVTDQGILYVSED
GKYLFEGKLYELTNNGPVDVAGKILVDKLNSYKDEMIVYPAKNEKHVVTVFMDITCHYCH
LLHQQLKEYNDLGITVRYLAFPRAGMNNQTAKQMEAIWTAKDPVFALNEAENGNLPKEVK
TPNIVKKHYELGIQFGVRGTPSIVTSTGEVIGGYLKPADLLRALEETAE
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatttttaccgcacttttgtgcgtggctgcggctaatgcaatggcagatgat
gcggcaattaaacgcaaattacagtcttttaatgtatcaaatattgctattaaatcttcg
ccgatttcaggcattagaacggctgtcacggatcaaggtatactttatgtgagcgaagat
ggaaaatatctttttgaaggtaaactttatgaactcacaaataatggccctgttgatgtc
gcaggtaaaattttagtggataaacttaattcttataaagacgagatgattgtttatcct
gcgaaaaatgaaaaacacgtagtaacagtatttatggatattacctgccattattgccat
ttgttacatcagcaattaaaagaatataacgatcttggtattactgtgcgttatttagct
ttccctcgcgcaggtatgaataatcaaacggcgaaacaaatggaagcgatttggacggcg
aaagatcccgtttttgctttaaacgaagctgaaaacggtaatctaccaaaagaagttaaa
acgccaaatatcgtgaaaaaacattatgaattaggtattcaatttggtgtacgaggaacg
ccaagtattgtgacttcaacgggagaagttattggcggttatttaaaacccgctgattta
ttaagagcacttgaagaaacagcagaataa

DBGET integrated database retrieval system