KEGG   Haemophilus influenzae R2846 (nontypeable): R2846_1148Help
Entry
R2846_1148        CDS       T01980                                 

Gene name
sucC
Definition
(GenBank) Succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
hie  Haemophilus influenzae R2846 (nontypeable)
Pathway
hie00020  Citrate cycle (TCA cycle)
hie00640  Propanoate metabolism
hie00660  C5-Branched dibasic acid metabolism
hie01100  Metabolic pathways
hie01110  Biosynthesis of secondary metabolites
hie01120  Microbial metabolism in diverse environments
hie01130  Biosynthesis of antibiotics
hie01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hie00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    R2846_1148 (sucC)
   00640 Propanoate metabolism
    R2846_1148 (sucC)
   00660 C5-Branched dibasic acid metabolism
    R2846_1148 (sucC)
Enzymes [BR:hie01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     R2846_1148 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ADO96541
Position
complement(1207054..1208223)
Genome map
AA seq 389 aa AA seqDB search
MNLHEYQAKQLFEHYGLPVKNGAVCQSVDEVDLVLAQLSGDKWAAKCQVHAGGRGKAGGV
KLVHDVEEARSFAEKWLGQRLVTFQTDKLGQPVNQIYFEETCDIDKEFYLSAVVDRASQK
VVFIASPAGGMNIEEVAQNSPHLLHKVTIDPLFGGLPYQGRELAFKLGLSGTQNKQFTDI
FMGLSRLFLEKDLSLVEVNPLVLTQQGNLVCLDAKISVDDNALFRHKDLLALQDLTQNDA
REAEAEKFQLNYVALEGDIGCMVNGAGLAMGTMDIVKLYGGKPANFLDVGGGATQERVAE
AFKIILTDPSVKVILVNIFGGIVRCDLIAEGVIAAVNEVGVRVPVVVRLEGTNAEIGRQI
LVESDVNILTAQSLQQAAELAVNAAKGEH
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacacgaatatcaagcaaaacaactatttgagcattatggattacccgtaaaa
aatggggcagtctgtcaatctgttgatgaagtagatttggtactggcccaactttcaggc
gataagtgggcggcgaaatgccaagttcatgcgggtgggcgtggtaaagcgggtggcgtt
aaattagtgcacgatgtagaggaagcaagatcttttgcagaaaaatggctaggacaacgt
ttagtcacttttcaaacggataaattgggtcagccagtaaaccagatttattttgaagaa
acttgcgatattgataaagaattttacttaagtgcggttgttgatcgtgcctctcaaaaa
gtggtgtttattgcttctcctgctggtggaatgaatattgaagaagtcgcgcaaaattca
ccgcacttactccataaagtaaccattgatcctttatttggaggattgccttatcaaggc
cgtgaattggcgtttaaattagggttaagtggtacgcaaaacaaacagtttaccgatatc
tttatgggcttatctcgtttgtttttagaaaaagatttatctttagtggaagtcaatcca
cttgttctcactcaacaaggcaatttggtttgtctcgatgccaaaatatctgtcgatgat
aacgctttatttcgccataaagatttattggcactgcaagatttaactcaaaatgatgcc
cgtgaagcagaagctgaaaaattccagttaaactatgtggctttagagggcgatattggt
tgtatggtaaatggggctgggcttgcaatgggcaccatggatattgtgaaactctatggt
gggaagcctgcgaattttcttgatgtgggtggtggtgcaacgcaagagcgggttgctgaa
gcgttcaaaatcattttaaccgatccttccgttaaagtgattttagtgaatatttttggt
ggcattgttcgttgtgatttgattgctgaaggcgtgattgctgcagtaaatgaagtgggc
gtgagagtgcctgtggttgtgcgattagaaggaacgaatgctgaaatcggtcgtcaaatt
ttagtggaaagtgacgttaatattcttaccgcacagagtttacaacaagccgcagaatta
gccgtgaatgcagcaaaaggagaacactaa

DBGET integrated database retrieval system