KEGG   Haemophilus influenzae R2846 (nontypeable): R2846_1646Help
Entry
R2846_1646        CDS       T01980                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
hie  Haemophilus influenzae R2846 (nontypeable)
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:hie00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1723086..1724597)
Genome map
AA seq 503 aa AA seqDB search
MTDKKYIIALDQGTTSSRAVLLDHNANVVEIAQREFTQIYPRAGWVEHNPMEIWATQSST
LNEVVAKAGITSDEIAAIGITNQRETTIVWEKSTGTPVYNAIVWQCRRTADITDKLKADG
HEEYIRNTTGLVVDPYFSGTKVKWILDNVEGAREKAERGELLFGTVDTWLVWKLTQSRVH
VTDYTNASRTMLFNIHTKQWDDKMLEILNIPRSMLPEVRNSSEIYGQTNIGGKGGVRIPV
AGIAGDQQAALYGHLCVHAGQAKNTYGTGCFMLLHTGNKAITSKNGLLTTIACNAKGEPK
YALEGSVFIAGASIQWLRDELKIVHDSFDSEYFAQKVTDSNGVYVVPAFTGLGAPYWDPY
ARGAIFGLSRGANRNHIVRATLESIAYQTRDVLEAMQSDSGERLQYLRVDGGATNNNFLM
QFQADILDVNVERPVVKEVTALGAAYLAGLATGFWKDLDELRDKARVERTFSPDSDNEKR
ERRYKGWKKAVKRSLEWAKEDEE
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgacagacaaaaaatacatcattgcattagaccaaggcacaacaagctctcgcgcagta
ttattagatcataatgcgaatgtggttgaaattgcacaacgtgaatttacccaaatctac
cctcgagctggttgggtagaacataacccaatggaaatttgggcaactcaaagctcaacc
ttaaacgaagtcgttgcaaaagcgggcattacatctgatgaaatcgctgctatcggtatc
accaaccaacgtgaaaccaccattgtatgggaaaaatcaaccggtacacctgtttacaac
gcgatcgtttggcaatgccgccgtactgcagacattaccgataaattaaaagccgatggc
catgaagaatatattcgtaataccacaggcttagtggttgacccttacttctctggtaca
aaagtaaaatggattttggataacgttgaaggcgcacgagaaaaagctgaacgaggcgaa
ttattatttggtaccgttgatacttggcttgtatggaaattgactcaaagccgagtgcac
gtaaccgattataccaacgcatctcgtaccatgttatttaacatccatactaaacaatgg
gatgacaagatgcttgaaatcttgaatattcctcgttcaatgttacctgaagtacgtaat
tcttctgaaatttacggccaaaccaatatcggtggtaaaggtggtgtgcgtattcctgtt
gcagggattgctggtgaccaacaagccgctctttacggacatctttgcgtacatgcaggc
caagccaaaaacacttacggcacaggttgctttatgttactccacacgggtaacaaagct
attacatccaaaaatggactactcacaaccattgcttgtaatgcaaaaggcgaaccaaaa
tatgccttagaaggttctgtatttatcgcgggtgcatcaatccaatggctccgtgatgaa
ctcaaaattgttcacgatagttttgactctgaatactttgcacaaaaagtgactgatagt
aatggcgtatatgttgttccagctttcacaggcttaggtgcaccatattgggatccatat
gcgcgcggtgcgatttttggtctttctcgcggcgcaaaccgtaatcatattgttcgcgca
accttagaatctattgcttaccaaacccgtgatgtcttagaggctatgcaatcagattcg
ggtgaacgattacaatatctccgtgtagatggtggtgcgacaaacaataacttcttaatg
caattccaagctgacattttagatgtaaatgtagagcgtccagttgtgaaagaagtaaca
gcgctaggcgcagcttatcttgctggtttagcaacgggcttctggaaagatttagacgag
cttcgcgataaagcccgtgtagaacgcaccttcagtccagacagcgacaatgaaaaacgt
gaacgtcgctacaaaggctggaaaaaagcagttaaacgctcattagaatgggcaaaagaa
gatgaagaataa

DBGET integrated database retrieval system