KEGG   Haemophilus influenzae F3031 (nontypeable): HIBPF00110Help
Entry
HIBPF00110        CDS       T01395                                 

Definition
DNA polymerase III subunit psi
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
hif  Haemophilus influenzae F3031 (nontypeable)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:hif00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    HIBPF00110
   00240 Pyrimidine metabolism
    HIBPF00110
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    HIBPF00110
   03430 Mismatch repair
    HIBPF00110
   03440 Homologous recombination
    HIBPF00110
Enzymes [BR:hif01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     HIBPF00110
DNA replication proteins [BR:hif03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     HIBPF00110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(10471..10875)
Genome map
AA seq 134 aa AA seqDB search
MNRRDLLLQEMGISQWELYRPEVLQGSVGISVAENIRFITVSDENISSSPLLADVLLSLN
LKKENCLCLNYDQIQHMECKQPIRYWLLSENSDQIDRTLPFCKQAEQVYRSPSWQQFQSN
HQAKRALWQQIQQP
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgaacaggcgcgatcttcttttacaagaaatgggcatttcccagtgggaattatatcgc
cccgaggtactgcaaggttcagtaggaattagtgtggcagagaatattcgctttatcact
gtttccgatgaaaatatcagtagctcgcctttgttggctgatgtgctgttaagccttaat
cttaaaaaagaaaattgtttatgtttgaattacgatcaaatccagcatatggaatgtaag
cagcctattcgttattggttactatcagaaaatagcgaccaaattgaccgcactttgcca
ttttgcaagcaggctgagcaggtttatcgctcgccaagttggcagcaatttcaatctaat
catcaagccaaacgagcgttgtggcaacaaattcagcagccttaa

DBGET integrated database retrieval system