KEGG   Haemophilus influenzae F3031 (nontypeable): HIBPF00990Help
Entry
HIBPF00990        CDS       T01395                                 

Definition
lysozyme precursor phage protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
hif  Haemophilus influenzae F3031 (nontypeable)
Brite
Enzymes [BR:hif01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     HIBPF00990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(99097..99657)
Genome map
AA seq 186 aa AA seqDB search
MSKKLGAMILCSAAAVVTAFFAQQKDLPAQQQNQVSLKAVSMIVNLEGCVRNPYKCPADV
WTNGVGNTHNVDKTKILTIDEVAVDLRQNIKQAENCINADFNGRKMNQDQYDAMISLAFN
VGCGNIKTYYSKTQGKRVATTLYRAAQAENWILMCNRIEDFNKSAGRVLKGLQIRRAKEK
ALCLGE
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaaattaggtgcaatgattttatgttcggcagctgcggtagtaacggctttt
tttgcccagcagaaagacttgccagcgcaacaacaaaatcaagtaagcttaaaagcggtg
tcaatgatcgtaaatttagaaggttgcgtgcgcaatccgtataaatgccccgccgatgtc
tggacaaatggcgtaggcaatacccataacgtagataaaaccaagattttaaccattgat
gaagtggcagtcgatttacgccaaaacatcaaacaggctgaaaattgcattaacgccgat
ttcaacggtcgcaagatgaatcaagatcaatatgatgccatgatatcactcgcctttaat
gtgggctgtggcaacatcaaaacctattacagcaaaacccaaggcaaacgtgtcgcaacc
acgctttatcgtgcagcacaagcggaaaactggatattaatgtgcaatcgtattgaagat
tttaacaaatcagctggacgcgtgctgaaaggcttacaaatccgcagagcaaaagaaaaa
gccctatgtttgggggaataa

DBGET integrated database retrieval system