KEGG   Haemophilus influenzae F3031 (nontypeable): HIBPF01290Help
Entry
HIBPF01290        CDS       T01395                                 

Gene name
thrC
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hif  Haemophilus influenzae F3031 (nontypeable)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hif00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HIBPF01290 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HIBPF01290 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HIBPF01290 (thrC)
Enzymes [BR:hif01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HIBPF01290 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(118424..119701)
Genome map
AA seq 425 aa AA seqDB search
MNLYNIKHPEEQVTFSQAVRQGLGRDQGLFFPEVIPKLNNINELLELPLVERSQKILGAL
IDGELPQATLDAMVKNAFTFTAPLEKVEDNIYALELFHGPTLAFKDFGGRFMAQALAAVR
GDGKITILTATSGDTGAAVAHAFYGLENINVVILYPKGKISPLQEKLFCTLGGNIRTVAI
NADFDACQALVKQAFDDVELRQTIRLNSANSINISRLLAQVCYYFEAVAQLPKEKHDNVV
VSVPSGNFGNLTAGLIAKTLGLPIKRFVASTNANDTVPRYLKSGNWEPKTTVATLSNAMD
VSRPNNWPRVEELFKRNGWDLTDLGSGMLSDSETEDSLKAMQSKGYLCEPHGAIAYQVLK
DQLKASETGIFLCTAHPAKFKESVERILGIQLPLPETLDKHNQLPLLSDEMDNDFAQLRA
YLLKS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaatttatacaatatcaaacacccagaagaacaagtcactttttctcaggctgttcgt
caaggtcttgggcgggatcaaggtctattctttccagaagttattcctaaacttaataac
attaatgaattacttgaattgcctcttgttgagcgtagtcaaaaaattctaggtgcatta
attgatggcgagttaccacaagcaactttagatgcaatggtaaaaaatgcgtttactttc
actgcaccgttagaaaaagtggaagataatatttatgcacttgaattatttcacggtcca
acgctagcatttaaagattttggtgggcgttttatggcacaggcacttgctgcggtacgt
ggcgatggcaaaattactattttaacggcaacctcaggcgatactggagccgctgtagca
catgcgttttatggattagaaaatattaatgtagttatcctttatccaaaaggcaaaatc
agcccattgcaagaaaagctattctgtactttaggtgggaatattcgtactgttgctatt
aacgctgatttcgatgcgtgtcaggctttagttaaacaagcctttgatgatgttgaatta
cgccaaactatccgacttaactctgcaaattctattaatatcagccgtttattagctcaa
gtttgttattactttgaggctgtcgcacaattgccaaaagaaaaacatgataatgttgtg
gtttctgtgccaagtggtaattttggtaacttaactgcgggattaattgcaaaaacctta
ggcttgccgataaaacgctttgtcgcctcaacaaacgcaaatgatactgtgccacgttat
ttgaaatcgggtaattgggagcctaaaacgacagttgcaaccctttctaatgcaatggat
gtaagtcgcccaaataattggccgagagtggaggaattgtttaaacgaaatggttgggat
ttaactgatttaggttcggggatgctaagtgatagcgaaacagaagatagcttaaaagcg
atgcagtcgaaaggttatttatgtgaacctcacggtgcgatagcttatcaggtgttgaaa
gatcaacttaaagcgagtgaaacaggaatcttcctgtgtacggcgcatcctgcgaaattt
aaagaatccgtagaacgtattcttggtattcagcttccattacctgaaacactggataaa
cataatcagctaccattgctttctgatgaaatggataatgattttgcacaactacgggct
tacttattgaagtcataa

DBGET integrated database retrieval system