KEGG   Haemophilus influenzae F3031 (nontypeable): HIBPF02570Help
Entry
HIBPF02570        CDS       T01395                                 

Definition
holliday junction DNA helicase ruva
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
hif  Haemophilus influenzae F3031 (nontypeable)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hif00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HIBPF02570
Enzymes [BR:hif01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     HIBPF02570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(263445..264059)
Genome map
AA seq 204 aa AA seqDB search
MIGRLQGILLEKQPPEILLNVQGVGYELLLPMTSFYDLPEIGQETTLFTHLVVREDAHLL
FGFAQKTDRTLFRELIKTNGVGPKLALAILSAMSVEQFAYAIEREELSKLTKIPGVGKKT
AERLLVELKGKFKGIKQSDFFVESTHIPLSPSIESHSESSSDEAISALIALGYKPAEAEK
MVKLVAKPELTSEQVIREALKAAL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgattggtcgcttacaaggcattcttttagaaaaacaacctccagaaattttactcaat
gtgcaaggcgtaggctatgaattgcttttgccgatgacgagtttctatgatttaccagaa
attggacaagaaactactttattcacccatcttgttgttcgggaagatgctcacttactc
tttggatttgcccagaaaacagaccgcactttatttcgtgaattaattaaaacaaatggg
gttgggcctaaattagccttagcgattttatccgccatgtcggtcgaacaatttgcttac
gcaattgagagagaagaactttctaaactcactaaaattccaggtgttggcaaaaaaaca
gctgaacgtttgttagttgaactcaaaggtaaatttaaaggcataaaacaaagtgatttc
tttgtagaaagtacgcatattccattatccccatctattgaatcccactcggaaagttca
tctgatgaagcaatttcagccttgattgctttaggttataaacctgcagaagcagaaaaa
atggtaaaactcgttgctaaacctgaattaaccagtgaacaagttattcgtgaagcatta
aaagccgcattgtag

DBGET integrated database retrieval system