KEGG   Haemophilus influenzae F3031 (nontypeable): HIBPF06080Help
Entry
HIBPF06080        CDS       T01395                                 

Definition
dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
hif  Haemophilus influenzae F3031 (nontypeable)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hif00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HIBPF06080
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HIBPF06080
   00020 Citrate cycle (TCA cycle)
    HIBPF06080
   00620 Pyruvate metabolism
    HIBPF06080
Enzymes [BR:hif01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     HIBPF06080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(554118..555764)
Genome map
AA seq 548 aa AA seqDB search
MSKQIQIPDIGSDEVTVTEVMVNVGDTISVDQSIINVEGDKASMEVPAPEAGVVKEILVK
VGDKVSTGTPMLVLEAAGAAPVADAPTAPVVATAPTASAIVEVNVPDIGSDEVNVTEIMV
KVGDSVEVDQSIINVEGDKASMEVPAPIAGVVKEILINVGDQVSTGKLIMKFETASAAPA
AEVAPAQVATPAAPAASASTSAQAPQAAAPDTTAQAAQSNNNVSGLSQEQVEASTGYAHA
TPVIRRLAREFGVNLDKVKGTGRKGRIVKEDIEAYVKTAVKAYESGATAQTTGNGVANGA
GLGLLPWPKVDFSKFGEIEEVELSRINKISGANLHRNWVIIPHVTHFDKADITDLEAFRK
EQNALAEKQKLGVKITPVVFIMKAVAKALEAYPRFNSSITEDAQRLILKKYINIGVAVDT
PNGLVVPVFKNVNKKGIIELSRELMEVSKKAREGKLTASDMQGGCFTISSLGGIGTTHFA
PIVNAPEVAILGVSKSSMEPVWNGKEFAPRLILPMSLSFDHRVIDGADGARFISYLGSVL
ADLRRLVM
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaacaaattcaaattcctgatattggtagtgatgaagttaccgtaacagaagtc
atggtaaacgtaggcgataccatttctgttgatcaatctatcattaacgttgaaggcgat
aaagcttcaatggaagtgcctgcaccagaagcgggtgttgtaaaagaaattttagtcaaa
gtgggcgataaagtttcaactggtactccaatgcttgtattagaagcggcaggtgctgct
ccagtagctgatgcgcctactgcaccagtggttgctaccgcaccaacggcttcagctatt
gtagaagtaaatgtgccagatattggatctgatgaagtcaatgttactgaaattatggtt
aaagtgggcgatagcgttgaagttgatcaatcaatcatcaatgttgaaggcgataaagct
tcaatggaagttccagcaccaattgctggcgtagtaaaagaaattttaattaatgtcggt
gatcaagtttcaacaggcaaattgattatgaaatttgaaacggcatctgcggcaccagca
gcggaagttgctccagctcaagtggctacacctgcagcgccagcagcatcagcttcaaca
tcagcacaagcaccacaggcagcagctcctgatactactgcacaagcagctcaatcaaat
aacaacgtatctggattaagccaagaacaagtagaagcaagtacaggatatgcacacgca
acaccagttattcgtcgtttagctcgtgaatttggtgtaaatctagataaagtaaaaggt
actggtcgtaaaggtcgtatcgttaaagaagatattgaagcttatgtgaagaccgcagtt
aaagcttatgaaagcggtgcaacagcacaaactactggcaatggtgtagcaaatggtgct
ggattaggcttattgccatggccaaaagttgatttcagtaaatttggcgaaattgaagaa
gttgaattaagtcgtatcaacaaaatttcaggtgctaacttacatcgtaactgggtaata
attccacacgttactcacttcgataaagcagatatcacggatttagaagcattccgtaaa
gaacaaaatgcgttagcagaaaaacaaaaactcggcgtaaaaatcacgccagttgtgttc
attatgaaagcggtggcaaaagcattagaagcgtatccacgtttcaatagctcaattacc
gaagatgctcaacgcttaatcctgaaaaaatatattaacatcggtgtcgcagtagatacg
ccgaatggcttagtcgtgcctgtattcaaaaatgtgaacaagaaaggcattatcgaactt
tcacgtgaattaatggaagtatcgaaaaaagcccgtgaaggcaaattgactgcatctgat
atgcaaggtggctgtttcaccatttcaagtcttggtggtattggtacaacgcactttgcg
ccaatcgtaaatgcgccagaagttgccatccttggtgtgtctaaatcatcgatggaacca
gtatggaatggtaaagaatttgcgccacgcttaattcttccaatgtcattatcattcgac
caccgtgtcattgatggtgcagatggcgctcgtttcattagctatcttggctctgtttta
gcagatttacgtcgtttagtaatgtaa

DBGET integrated database retrieval system