KEGG   Haemophilus influenzae F3031 (nontypeable): HIBPF07640Help
Entry
HIBPF07640        CDS       T01395                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
hif  Haemophilus influenzae F3031 (nontypeable)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:hif00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:hif00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:hif03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:hif03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:hif03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(721834..722268)
Genome map
AA seq 144 aa AA seqDB search
MAKTAQFYILTENCTLTVEEIACNLAASIWRSGKKVLISCESESQALEIDELLWQRDPNE
FVPHNLSGEATQYPTPIEISWLGKRNLQRRDVLINLQQEIPDFSHSFTQLIDFVPKDDAL
KTQARERYKQLRALGWALSTENIA
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaactgcacaattttatattcttacggaaaattgtactttaactgtcgaagaa
atagcctgtaatcttgctgcttcaatatggcgctctgggaaaaaagtactaattagttgc
gaaagtgagagccaagcattagaaattgatgaacttttgtggcaacgagatcctaatgaa
tttgttccacataatttatcgggtgaggcaacacaatatcccacaccgattgagatttca
tggcttggaaaacgaaatttacaacgccgtgatgtgttaatcaatttgcaacaagaaatc
ccagattttagccatagcttcacccaacttattgattttgtaccgaaagatgatgcttta
aaaacacaagctcgagaacgttacaaacagttaagagcattgggatgggcactttctaca
gaaaatatagcataa

DBGET integrated database retrieval system