KEGG   Haemophilus influenzae F3031 (nontypeable): HIBPF07750Help
Entry
HIBPF07750        CDS       T01395                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hif  Haemophilus influenzae F3031 (nontypeable)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hif00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HIBPF07750
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HIBPF07750
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HIBPF07750
Enzymes [BR:hif01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HIBPF07750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
733001..733810
Genome map
AA seq 269 aa AA seqDB search
MSRFETQFATLNAKNEGAFVPFVTLCDPTFDRSFEIICTLVDNGADALELGFPFSDPLLD
GPVIQAANNRALTAGHSSEDSFKLLEKVRSKYPEIPISLLLCANLIFAKGLDAFYQRCAE
VGVDAVLVADIPLLAKEDYVQAAKKYGIQPVFICPPNADEKTIQGVAKNSEGYTYLVSRT
GVTSAENQAHAANLDTLIEQLKAHNAPPILQGFGIAQPEQVKDALSLGAAGVISGSATVK
IIERNLDNQAKLLEELNDFVRAMKQATQA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagccgttttgaaacgcaatttgcgacacttaacgcaaaaaatgaaggggctttcgtg
ccgttcgttaccctttgcgaccctactttcgaccgctcttttgagatcatttgcacactt
gtggataacggtgcagatgctttagaactcggttttcctttttccgatccgctactcgat
ggcccagttattcaagccgcgaataatcgtgctttaactgcaggtcatagcagtgaagat
agctttaaactattggaaaaagtgcggtcaaaatatccagagattccgattagcttatta
ctttgtgccaatttaatttttgctaaaggtttagatgctttttatcaacgttgtgcagaa
gtcggggttgatgctgtgcttgtagcagatattccgttactcgcaaaagaagattatgta
caagcggccaaaaaatacggtattcaacccgtctttatttgcccgccaaatgcggacgag
aaaacgatccaaggcgtagcgaaaaatagcgaaggctatacctatttagtctcacgcaca
ggcgtaaccagtgcagaaaatcaagctcatgcagcaaatttagatacccttatagaacag
cttaaggcgcataatgccccgccaattttacaaggcttcggcattgctcaaccagagcaa
gttaaagacgcgttatctttgggggcagccggtgtgatttcaggttcggcaacggtgaaa
attattgagcgaaatttggataatcaggcgaaattgctcgaagaacttaacgattttgtg
agagcaatgaaacaggctactcaggcttaa

DBGET integrated database retrieval system